Tap / click on image to see more RealViewsTM
Sale Price $20.49.  
Original Price $24.10 Comp. value
per shirt
You save 15%

Kitty Bride To Be Tshirt with White Background

Qty:
Womens Basic T-Shirt
+$9.45
+$23.45
+$10.30
White
Classic Printing: No Underbase
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Women's Basic T-Shirt

This basic t-shirt features a relaxed fit for the female shape. Made from 100% cotton, this t-shirt is both durable and soft - a great combination if you're looking for that casual wardrobe staple. Select a design from our marketplace or customize it and unleash your creativity!

Size & Fit

  • Model is 5’7” and is wearing a small
  • Standard fit
  • Fits true to size

Fabric & Care

  • 100% cotton
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold
  • Imported

About This Design

Kitty Bride To Be Tshirt with White Background

Kitty Bride To Be Tshirt with White Background

Adorable Kitty Bride To Be Tshirt - white Background and painting motif by Lisa Lorenz

Customer Reviews

4.6 out of 5 stars rating583 Total Reviews
419 total 5-star reviews120 total 4-star reviews30 total 3-star reviews11 total 2-star reviews3 total 1-star reviews
583 Reviews
Reviews for similar products
5 out of 5 stars rating
By Iuliia F.February 18, 2014Verified Purchase
Womens Basic T-Shirt, White, Adult S
Creator Review
The parsel arrived during 28 days, that's pretty fast, because I live in Europe and Shipping usually takes a month or so. The quality is good, it is 100% cotton, very soft and warm when touching. I will definitely wear it during summer days. The shirt is wide a little to my waist, maybe next time I will took a fitted one. I added a gift label for fun. The printing is very, very good! I say it because I drew this picture myself and here it looks exactly like on the image. Every line is seen very clear. I'm satisfied.
5 out of 5 stars rating
By Shantelle D.July 10, 2025Verified Purchase
Bella+Canvas Short Sleeve T-Shirt, Black, Adult L
We are wearing these matching shirts at our co-ed bach party as we share our last night together as single folks with our friends. The shirts are high quality and it's nice to have a female version of the male shirt so that it fits my body perfectly.
5 out of 5 stars rating
By Pamela R.December 21, 2025Verified Purchase
Womens Basic T-Shirt, White, Adult S
Great product!! My granddaughter is going to be so happy to see her design on a shirt!!! Can't thank you enough!

Tags

T-Shirts
catkittybrideweddingrosesveilmarriagewhitepinktshirt
All Products
catkittybrideweddingrosesveilmarriagewhitepinktshirt

Other Info

Product ID: 235234092952079184
Created on: 7/23/2007, 2:09 PM
Rating: G 
Related Searches
weddingsweddings