Tap / click on image to see more RealViewsTM
Sale Price $2.78.  
Original Price $3.26 Comp. value
per card
You save 15%

Loving Words Valentine's Day Greeting Card

Qty:
Choose Your Format

Envelopes

Choose from blank envelopes or save time with addressable envelopes

Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$0.64
+$0.64
-$0.16

Other designs from this category

About Folded Holiday Cards

Sold by

Size: Standard, 5" x 7"

Wishing everyone a season of gladness, a season of cheer, and to top it all off, a wonderful year. Holiday cards designed to brighten up the entire year.

  • Dimensions: 5" x 7" (portrait); 7" x 5" (landscape)
  • Full color CMYK print process
  • Double sided printing for no additional cost

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Loving Words Valentine's Day Greeting Card

Loving Words Valentine's Day Greeting Card

a unique approach to valentine's day cards...© 2004-2014 MarloDee Designs :: All rights reserved. All necessary licenses have been purchased and are on file. Images on this site are NOT public domain. You may not copy, duplicate, alter or scan these designs, images, illustrations, photography, art and writing.

Customer Reviews

4.9 out of 5 stars rating6.8K Total Reviews
6311 total 5-star reviews333 total 4-star reviews62 total 3-star reviews32 total 2-star reviews59 total 1-star reviews
6,797 Reviews
Reviews for similar products
5 out of 5 stars rating
By Kari Y.February 10, 2021Verified Purchase
Folded Holiday Card, Size: Standard, 5" x 7", Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
I ordered this card for my husband for valentine's day and it turned out beautifully! The color is clear and soft the way I wanted it and the pictures i uploaded look wonderful! 10/10 will use again and would recommend to anyone. Beautiful soft colors. Clear, gorgeous pictures and text. Not only did my card arrive on time it arrived a day early and I ordered only 6 days before Valentines day!
5 out of 5 stars rating
By Evelyn H.March 1, 2017Verified Purchase
Folded Holiday Card, Size: Standard, 5" x 7", Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
I am extremely happy with this Valentine's Day card that I bought for my boyfriend. I was so pleased it even showed up earlier than expected. The quality of this card is fantastic. The colors are vibrant, the card stock is heavy & being able to customize it was a bonus.
5 out of 5 stars rating
By Fozia F.February 15, 2025Verified Purchase
Folded Holiday Card, Size: Standard, 5" x 7", Paper: Signature Matte, Envelopes: White
Good quality card, simple yet nice design, and it arrived quickly. I added a photo on the back of the card and the image printed is very clear. Next time, I‘ll try the semi-gloss finish. I am really happy with the finish of the card!

Tags

Folded Holiday Cards
valentinesdaylovesweetestweddingpinkchicstylishunique
All Products
valentinesdaylovesweetestweddingpinkchicstylishunique

Other Info

Product ID: 137642364302511547
Created on: 1/19/2014, 3:27 PM
Rating: G