Tap / click on image to see more RealViewsTM
Sale Price $1.92.  
Original Price $2.25 Comp. value
per sticker
You save 15%

Martians discharging Heat-Rays Sticker

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Tiny 2" x 2"

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 2" L x 2.5" H
  • Design Area: 2" L x 2" H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.125" border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Martians discharging Heat-Rays Sticker

Martians discharging Heat-Rays Sticker

Martians discharging Heat-Rays in the Thames Valley. Illustration by Henrique Alvim Corrêa. Illustration from the 1906 Belgium (French language) edition of H.G. Wells' "The War of the Worlds", 1906.

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
890 total 5-star reviews64 total 4-star reviews27 total 3-star reviews27 total 2-star reviews79 total 1-star reviews
1,087 Reviews
Reviews for similar products
5 out of 5 stars rating
By Aurelia T.May 5, 2022Verified Purchase
Extra-Large 14" x 14" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was able to give us a designer the dimensions of my mini shot glasses and she was able to reduce all the labels onto one sheet we’re all I did was going to change the names and add the table number for my seating chart absolutely perfect. Simple perfect easy to read fit great on my jar
5 out of 5 stars rating
By Nichole M.August 9, 2020Verified Purchase
Large 8" x 8" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These turned out so beautifully and all our guests loved them!! They did not have the orange suit sleeves so I ordered them separately and they fit perfectly into the mailing envelope. I had an issue with the address labels not being ledge able and they redid them and replaced them. They are perfect!
5 out of 5 stars rating
By Jenn K.August 20, 2019Verified Purchase
Medium 6" x 6" Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
Good quality vinyl stickers that stick well but also can be removed without residue. Funny eyes for all sorts of stuff. Printing turned out great and looks just as it appears online.

Tags

Custom-Cut Vinyl Stickers
henrique alvim corrêaclassic sci ficlassic science fictionhg wellscreepyscarymartiansvintage nostalgiathe war of the worldsstickers
All Products
henrique alvim corrêaclassic sci ficlassic science fictionhg wellscreepyscarymartiansvintage nostalgiathe war of the worldsstickers

Other Info

Product ID: 256617797806193545
Created on: 6/15/2023, 11:34 AM
Rating: G