Tap / click on image to see more RealViewsTM
Sale Price $46.88.  
Original Price $55.15 Comp. value
per wallpaper roll
You save 15%

Maui Wallpaper | m3galleryStudio

Qty:

Other designs from this category

About Wallpapers

Sold by

Style: Textured vinyl

Introducing our Peel and Stick Wallpaper, a game-changer for effortless room transformations. This high-quality wallpaper features a matte finish and a hassle-free peel-and-stick application, making it a breeze to revamp your living spaces. Choose from textured vinyl or smooth vinyl and six different sizes, including a swatch so you can test the application, and find that perfect fit, ranging from small accent walls to large room makeovers.

  • Easy Maintenance: The wallpaper's smooth surface allows for easy cleaning and maintenance, making it perfect for busy households or high-traffic areas.
  • Residue-free Removal: When it's time for a change, our wallpaper can be easily removed without leaving any residue or damaging your walls, allowing for a hassle-free transition.
  • Versatile Design Options: Choose from a wide range of captivating designs, patterns, and colors to suit your personal style and enhance the ambiance of any room.
  • DIY-Friendly: Our Peel and Stick Wallpaper is designed for easy DIY installation, making it accessible to anyone. No professional skills or tools are required, saving you time and money.
  • Need some help hanging your wallpaper? Please check out our how-to guide here

About This Design

Maui Wallpaper | m3galleryStudio

Maui Wallpaper | m3galleryStudio

Bright botanical floral Hawaiian islands wallpaper

Customer Reviews

5.0 out of 5 stars rating1 Total Reviews
1 total 5-star reviews0 total 4-star reviews0 total 3-star reviews0 total 2-star reviews0 total 1-star reviews
1 Reviews
Reviews for similar products
5 out of 5 stars rating
By Awake A.April 12, 2025Verified Purchase
Custom Wallpaper 2' x 4', Textured vinyl
This is my second terrific, custom-designed Zazzle purchase. My custom-designed wallpaper is fabulous!! It arrived super well-packaged, and on time. It is really beautiful and of very high quality. I think this designer is extremely talented. She certainly knows how to follow instructions for a perfect custom design! You would do well to buy anything from Zazzle and, in particular, this designer. Excellent experience!!

The Ultimate Guide to Wallpaper

Learn how to use our peel & stick wallpaper for an easy and stylish way to transform any room!

READ NOW

Read "Stick to Fun: The Ultimate Guide to Peel-and-Stick Wallpaper" on Zazzle Ideas

Tags

Wallpapers
pinkflowersbohemianpolynesianhawaiiislandtikiwallpaperfloralmcm
All Products
pinkflowersbohemianpolynesianhawaiiislandtikiwallpaperfloralmcm

Other Info

Product ID: 256572724755182915
Created on: 5/23/2025, 8:50 PM
Rating: G