Tap / click on image to see more RealViewsTM
Sale Price $151.30.  
Original Price $178.00 Comp. value
per wall decal
You save 15%

"Medieval Life~16 Th Century- ITALIAN KITCHEN" Wall Sticker

Qty:
Single
Octogon
Left

Other designs from this category

About Wall Decals

Sold by

Number of Shapes: Walls 360 Custom Wall Decal

Brighten up any room with a custom wall decal from Zazzle and Walls 360! Printed with premium eco-solvent inks on high quality fabric paper, your images, text, and designs will pop off the wall with stunning clarity and color accuracy. Made to be moved, each wall decal can be peeled and repeeled up to one hundred times without damaging the decal or walls. No glue, no frames, no pain – make a space all your own with a customized wall decal!

  • Brilliant high-resolution printing on self-adhesive fabric paper.
  • Easy peel and restick up to 100 times. No wall damage or sticky residue.
  • Manufactured by Walls 360 in Las Vegas, Nevada.
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

"Medieval Life~16 Th Century- ITALIAN KITCHEN" Wall Sticker

"Medieval Life~16 Th Century- ITALIAN KITCHEN" Wall Sticker

Medieval cooks had no scruples about using and overusing sugar; to the contrary, medical thinking of the time actually considered it healthy. In England, though, honey remained the sweetener of choice well into the renaissance, and sugar settled into the same quasi medicinal status as spices. The variety of raw ingredients available to the medieval cook was largely similar to the selection we are presented with today. With the exception of items later brought over from the Americas (maize, chocolate, turkey), and some which were known but considered suspicious or downright poisonous (potato, tomato, banana), and a few which for other reasons reached Europe in later ages (coffee, tea, vanilla, broccoli), most the selection available to the medieval cook was largely similar to today's palette. The most important limitation on variety was imposed by what could be produced locally; through the medieval and renaissance period, import was a costly and time-consuming business, and so often priced its bounty out of reach for common folk. Typical food stuffs available were : Beef and marrow pies, hare soup, a white broth of coneys, capons and venison, white beet, turnips, salted olives; carp and sea-perch, jellied eels, partridge, plovers, whiting, pheasants and swans, pies of turtle-doves and larks, the best roast, a grill of shad, a fricassee, numbles and tail of boar with hot sauce, fat capons in pies, fritters and rich pasties, frumenty, venison, olives, cream fritters and sugared fried bread slices, forcemeat in hot galantine, a jelly of capons, coneys, chicks, young rabbits and pigs, hippocras, wafers, pears, shelled nuts.

Customer Reviews

4.8 out of 5 stars rating131 Total Reviews
116 total 5-star reviews13 total 4-star reviews0 total 3-star reviews0 total 2-star reviews2 total 1-star reviews
131 Reviews
Reviews for similar products
5 out of 5 stars rating
By Angie E.May 2, 2020Verified Purchase
12"x12" Square With Rounded Corners Wall Decal
Zazzle Reviewer Program
I was a little nervous to order wall decals because I used some back in the 80's and they were stick once and you couldn't really move them. These I bought from zazzle are FANTASTIC!! Easy to apply and move if your not happy where you placed them. Just like I wanted. They look perfect in my kitchen.
5 out of 5 stars rating
By J.April 13, 2016Verified Purchase
12"x12" Square Wall Decal
Zazzle Reviewer Program
Really pleased with this poster, everything i wanted. I came in good shape and looks as it did on the site i ordered it from. Can't wait to display it ! Very good quality paper and printing. The colors a very vivid. I love the it and i am very pleased !
5 out of 5 stars rating
By Jennifer A.August 17, 2021Verified Purchase
12"x18" Rectangle Wall Decal
Zazzle Reviewer Program
Easy to apply , nice material , looks great on my business door ! Great quality , not flimsy or cheap. Love it and getting a lot of attention

Tags

Wall Decals
medieval life16 th century italian kitchencookeryscullionmaidgrillingfryingpigschickensgeese
All Products
medieval life16 th century italian kitchencookeryscullionmaidgrillingfryingpigschickensgeese

Other Info

Product ID: 256883410648782566
Created on: 2/3/2013, 2:45 PM
Rating: G 
Related Searches
wall decalswall decals