Tap / click on image to see more RealViewsTM
Sale Price $12.71.  
Original Price $14.95 Comp. value
per sticker
You save 15%

Mermaid and Seahorse Tail Sticker

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Large 8" x 8" Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 8" L x 8.5" W
  • Design Area: 8" L x 8" W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.125" border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Mermaid and Seahorse Tail Sticker

Mermaid and Seahorse Tail Sticker

Mermaid and Seahorse Tail Sticker Stickers are cut to the exact shape of your image and produced using a custom cut (kiss-cut) process on vinyl sheets

Customer Reviews

4.7 out of 5 stars rating53 Total Reviews
47 total 5-star reviews2 total 4-star reviews1 total 3-star reviews1 total 2-star reviews2 total 1-star reviews
53 Reviews
Reviews for similar products
5 out of 5 stars rating
By Mindy B.November 12, 2019Verified Purchase
Medium 6" x 6" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I bought these decals for my daughter - she's personalized just about every water bottle she owns, so I thought it would be fun to add some acro love to the mix. They look great, and have held up in the dishwasher and through hand washing. The decal quality is great. The colors are rich and vibrant. There's a perfect border on each decal, too.
5 out of 5 stars rating
By J.October 24, 2022Verified Purchase
Extra-Large 14" x 14" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
This is a great product. The design is beautiful, and it went on so easily to my laptop. I love it. I have had so many compliments. It is bright and really shows off the design. The printing was great. It looks just like the picture that I ordered from. Nice and bright.
5 out of 5 stars rating
By Tellurian T.March 5, 2022Verified Purchase
Extra-Small 3" x 3" Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
Just the right colors and proportions to liven up a dull black phone case. I tried a version on transparent vinyl, but it didn't stand out enough. This version works well. Good color and accurate circle with this version; an earlier version was imperfectly cut, leaving a straight edge.

Tags

Custom-Cut Vinyl Stickers
stickerscustom stickerszazzle comgoogle comnew arrivalsmermaidsfantasykidsseahorsestickers for kids
All Products
stickerscustom stickerszazzle comgoogle comnew arrivalsmermaidsfantasykidsseahorsestickers for kids

Other Info

Product ID: 256041056802821286
Created on: 6/17/2021, 9:22 AM
Rating: G