Tap / click on image to see more RealViewsTM
Sale Price $1.90.  
Original Price $2.71 Comp. value
per card
You save 30%

Minimalist Cream Burgundy Elegant Damask Wedding Invitation

Wedding Collection
Qty:

Envelopes

Choose from blank envelopes or save time with addressable envelopes

Squared
+$0.20
+$0.25
+$0.25
+$0.25
+$0.25
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$1.44
+$0.59
+$0.59
+$0.59
-$0.16

Other designs from this category

Shop this wedding suite

Sifting Sunbeams
Akaya: The Damask Classic Wedding SuiteDesigned by Sifting Sunbeams
Tap / click on image to see more RealViewsTM
 
 
 
 
 
 
 
 

About Invitations

Sold by

Size: 5" x 7"

Make custom invitations and announcements for every special occasion! Choose from six curated paper types, two printing options, and six shape options to design a card that's perfect for you.

  • Dimensions: 5" x 7" (portrait or landscape)
  • Envelopes included but can be removed if not needed
  • High quality, full-color, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Two printing options available: Standard and High-Definition
  • 6 curated paper types to choose from
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 5" x 7". For best results please add 1/16" bleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Minimalist Cream Burgundy Elegant Damask Wedding Invitation

Minimalist Cream Burgundy Elegant Damask Wedding Invitation

Combine classic elegance and modern sophistication with these tasteful and stylish wedding invitations in cream and burgundy, featuring a hand-drawn damask motif. Choose from various colours and paper type to perfectly suit your style, and simply personalize it with your details.

Customer Reviews

4.8 out of 5 stars rating32.7K Total Reviews
28756 total 5-star reviews2877 total 4-star reviews527 total 3-star reviews244 total 2-star reviews336 total 1-star reviews
32,740 Reviews
Reviews for similar products
5 out of 5 stars rating
By AnonymousFebruary 10, 2022Verified Purchase
Flat Invitation, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Zazzle Reviewer Program
We ordered this invitation first as just a sample because I loved the color combination. We ordered many other samples invitations (thanks to Zazzle Black). But ultimately ended up coming back to this (our first) because is simply was exactly what I was looking for. I actually ended up using the color pallet for our entire wedding! We had an outdoor ceremony and inside reception and these invitations were the perfect introduction for our guests to the type of event we were planning. Not too fancy but also not a casual evening wedding. The colors were vibrant and the paper was just the right amount of weight. We ordered the matching RSVP cards, the mauve envelopes with return address printed on the back, the belly bands to tie it all together, and the menus. Postage to send all this out was only .78 each. We highly recommend these invites and this seller was very responsive, our orders went out very timely. Thank you so much! We were so happy with all your paper products! I was extremely satisfied with the colors of our invitations. I couldn't have been happier with the print!
5 out of 5 stars rating
By Kathryn L.October 18, 2020Verified Purchase
Flat Invitation, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Zazzle Reviewer Program
The product exceeded my expectations and was of high quality. the paper was thick and was a perfect invitation for my wedding. the colors were just as expected and vibrant. I have no worries that those receiving the invitations will know how much work was put into the product.
5 out of 5 stars rating
By N.July 29, 2016Verified Purchase
Flat Invitation, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Zazzle Reviewer Program
It's ok to go with the paper they offer its similar, and the truth it's people does not care about them and this has so many things to write on to express yourself that it's what matters the most . Save one a do not worry about people , they truly don't care , it's more as oh they are getting married ok ! And some people will say oh they are fancy , I never did that , that at some point you will think you went over the top, but u did not . ! So clear if u are thinking of a pic of you guys pay extra for the brightness and whatever but the truth it's people don't care ....sorry so it's not worth to stress over them it's my conclusion . In the end they are just going too look at them and be like now we have to worry about one more thing and weddings are boring and food it's never good...and ceremony it's going to bored them. So don't make ceremony long , unless your going to make them cry with ur speech snd they are going to fall madly in love with u guys. Make it short , make it fun , don't worry about nobody else but you two , because the truth is you are the only ones that can make your marriage work nobody else .... And always remember whatever people say does not matter ... Follow your heart, if they are honest , humble , kind and understand you you will know they are the one , and others opinions don't matter. When u want something and love it you will go above and beyond to present wherever you want ; and will always make it look good !!!!!!

Tags

Invitations
damaskhanddrawnclassyeleganttypographybudgetburgundycreamornatechic stylish
All Products
damaskhanddrawnclassyeleganttypographybudgetburgundycreamornatechic stylish

Other Info

Product ID: 256524667676963121
Created on: 2/25/2026, 7:33 AM
Rating: G