Tap / click on image to see more RealViewsTM
Sale Price $16.16.  
Original Price $17.95 Comp. value
per sticker
You save 10%

Minimalist Personalized Honemoon Hashtag Sticker

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: 14" x 14" Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 14" L x 14.5" W
  • Design Area: 14" L x 14" W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.125" border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Minimalist Personalized Honemoon Hashtag Sticker

Minimalist Personalized Honemoon Hashtag Sticker

#honeymoonvibe hashtag sticker in modern calligraphy writing for suitcases, cars and more. Just add your names or any custom text. You can also add your own hashtag if you like, but may need to ajust the font size to make sure it fits. To do this click on "Edit using design tool".

Customer Reviews

4.2 out of 5 stars rating6 Total Reviews
3 total 5-star reviews2 total 4-star reviews0 total 3-star reviews1 total 2-star reviews0 total 1-star reviews
6 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Caitlyn y.November 7, 2022Verified Purchase
3" x 3" Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
These customizable stickers are fantastic! I used them for the groomsmen in my wedding and they turned out perfect. Looks just like the picture!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Erica E.February 3, 2023Verified Purchase
3" x 3" Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
The finalized product was beautiful and perfect for what I needed it for. Printing was as described and the colors were vibrant!
4.0 out of 5 stars rating
4 out of 5 stars rating
By Linda C.May 20, 2021Verified Purchase
3" x 3" Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
I love the way these came out, but they did not show up on my project very well. Unfortunately, I didn’t have other options on how to make the best use of them so they are a little disappointing for me. It was the item that I was using them on that did not work out. These would be a great addition to other projects. The printing was wonderful. Very attractive.

Tags

Custom-Cut Vinyl Stickers
scriptminimalistnewlywedsgifthoneymoontravelcouplejust marriedcustomnames
All Products
scriptminimalistnewlywedsgifthoneymoontravelcouplejust marriedcustomnames

Other Info

Product ID: 256290166934541049
Created on: 11/29/2022, 12:36 AM
Rating: G