Tap / click on image to see more RealViewsTM
Sale Price $2.97.  
Original Price $4.95 Comp. value
per invitation
You save 40%

Modern Purple and Silver Photo Wedding Tri-Fold Invitation

Qty:
Personalize this template
Horizontal
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$0.55
+$0.55
-$0.15

Other designs from this category

About Trifold Letter Fold Invitations

Sold by

Size: 5" x 7"

An invitation for every occasion! The tri-fold letter fold design has more space to include all your important details.

  • Dimensions: 5" x 7" tri- fold
  • Full CMYK print process
  • Printing on all sides for no additional cost
  • Standard white envelopes included

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Modern Purple and Silver Photo Wedding Tri-Fold Invitation

Modern Purple and Silver Photo Wedding Tri-Fold Invitation

Modern, elegant, calligraphy script, marbled royal purple in combination with silver grey back details. Stylish, luxury tri-fold wedding invitation with custom photo inside. Add your photo, wedding details and rsvp.

Customer Reviews

4.7 out of 5 stars rating282 Total Reviews
234 total 5-star reviews28 total 4-star reviews6 total 3-star reviews5 total 2-star reviews9 total 1-star reviews
282 Reviews
Reviews for similar products
5 out of 5 stars rating
By Nichole R.May 18, 2024Verified Purchase
Trifold Letter Fold Invitation, Size: 5" x 7", Paper: Signature Matte, Envelopes: White
The invitations came out absolutely beautiful. We have received a lot of compliments on them. We were very happy with how they turned out. Overall they were good. There were a few that we cut improperly so I am glad we ordered some extra ones.
5 out of 5 stars rating
By JoAnn T.June 30, 2022Verified Purchase
Trifold Letter Fold Invitation, Size: 5" x 7", Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
I loved working with Zazzle start to finish. I was able to edit the invitation with the colors and even change some of the layout to create the exact invitation we wanted. We had pictures, added our story, and even used the back for a fun sequence going in for a kiss. When we submitted the purchase they looked over the document, had us correct some things due to a licensing issue, and when all was cleared the process began. Then we had an issue come up that needed us to change the date. Luckily the printing hadn't happened yet so we were able to cancel the order and reissue the card. When we got it we were very impressed! High quality paper and finish, and everything looked great. We would definitely recommend this company and this product! The finished product was amazing! Very high quality!
5 out of 5 stars rating
By LaShonda H.January 12, 2020Verified Purchase
Zazzle Reviewer Program
I was extremely impressed with the quality of the paper used to print out this invite! The colors were vibrant and glossy! The trifold idea was genius! For it made it so much more cost effective and easier for the guests to send back the RSVP's. The font was very elegant and professional! It exceeded my expectations! The colors turned out better than I expected and the quality of our images were spectacular! It made our engagement picture really stand out! We can't wait ot mail off our wedding invitations!
Original product

Tags

Trifold Letter Fold Invitations
photomodernpurpleweddingelegantgraysimplefaux silvertypographycalligraphy script
All Products
photomodernpurpleweddingelegantgraysimplefaux silvertypographycalligraphy script

Other Info

Product ID: 256197997045476690
Created on: 2/19/2020, 5:46 AM
Rating: G