Tap / click on image to see more RealViewsTM
The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.
Sale Price $27.63.  
Original Price $32.50 Comp. value
per keychain
You save 15%

Monogram Blue & Silver Filigree Motif Key Chain

Qty:
Premium Square
-$17.85
-$19.80
-$17.85
+$0.80
Large (2.00")

Other designs from this category

About Keychains

Sold by

Style: Premium Square Keychain

You will never lose your keys or forget your favorite memory with this custom square keychain from Zazzle. The waterproof, UV coating will keep your images looking like new for years to come and hold your memories fresh like they just happened yesterday!

  • Dimensions:
    • Measurements: 2" l x 2" w
    • Depth: 0.19"
    • Weight: 0.705 oz.
  • Full-color, full-bleed printing
  • Silver colored metal charm & ring
  • UV resistant and waterproof
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 1.83" x 1.83". For best results please add 1/16" bleed

About This Design

The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.
Monogram Blue & Silver Filigree Motif Key Chain

Monogram Blue & Silver Filigree Motif Key Chain

*Customize with your text.

Customer Reviews

4.6 out of 5 stars rating5.4K Total Reviews
4181 total 5-star reviews779 total 4-star reviews210 total 3-star reviews113 total 2-star reviews96 total 1-star reviews
5,379 Reviews
Reviews for similar products
5 out of 5 stars rating
By Gloria G.April 16, 2020Verified Purchase
Premium Square, Large (2.00")
Zazzle Reviewer Program
I wanted a key chain to remember my husband and son lost to cancer. Great quality and sharpnbess
5 out of 5 stars rating
By Caleo R.May 3, 2022Verified Purchase
Premium Square, Small (1.38")
Zazzle Reviewer Program
First and foremost, I really liked how this came in a cute Zazzle pouch. The keychain is absolutely high quality! Feels sturdy! You can be assured that your printed image will be protected. Image quality and colors are perfect. And to think that the resolution of my image wasn't exactly the highest.
5 out of 5 stars rating
By Sharon C.December 15, 2023Verified Purchase
Premium Square, Small (1.38")
Zazzle Reviewer Program
Loved this gift of our daughter ,grandson and granddaughter! This is a Christmas present for our Daughter. This gift turns out very clear and excellent print .i have ordered one last year and am very pleased With both key rings

Tags

Keychains
bluesilvermonogramclassychicelegantprettyfiligreelacesquare
All Products
bluesilvermonogramclassychicelegantprettyfiligreelacesquare

Other Info

Product ID: 146454319706538101
Created on: 6/17/2017, 7:50 PM
Rating: G