Tap / click on image to see more RealViewsTM
Sale Price $35.96.  
Original Price $39.95 Comp. value
per pillow
You save 10%

Mr & Mrs photo Throw Pillow

Qty:
16" Throw Pillow
+$7.50
+$20.10

Other designs from this category

About Pillows

Sold by

Size: 16" Throw Pillow

Accent your home with custom pillows from Zazzle and make yourself the envy of the neighborhood. Made from high-quality Simplex knit fabric, these 100% polyester pillows are soft and wrinkle-free. The heavyweight stretch material provides beautiful color definition for your design while also being the perfect complement to your couch!

  • Dimensions: 16" x 16" (square)
  • Simplex knit fabric; 100% polyester; wrinkle-free
  • Hidden zipper enclosure; synthetic-filled insert included
  • Machine washable
  • Made in the USA
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 16" x 16". For best results please add 0.59" bleed.

About This Design

 Mr & Mrs photo Throw Pillow

Mr & Mrs photo Throw Pillow

Celebrate love in elegant style with this timeless "Mr. & Mrs." script design. Featuring modern calligraphy with a romantic touch. Perfect for yourself or as a gift. Whether you're personalizing for yourself or as a gift, this classic motif adds a sophisticated and heartfelt touch to any occasion.

Customer Reviews

4.7 out of 5 stars rating223 Total Reviews
182 total 5-star reviews31 total 4-star reviews5 total 3-star reviews3 total 2-star reviews2 total 1-star reviews
223 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lisa C.November 27, 2023Verified Purchase
Throw Pillow, 16" Throw Pillow
Zazzle Reviewer Program
I bought this for my niece as part of a Bridal Shower Gift. I made my own revisions to the design, so I was a little nervous about it all. I'm super happy though with the end result! I changed out the background and revised all the text (on the back side as well). Printing turned out just wonderful!
5.0 out of 5 stars rating
5 out of 5 stars rating
By AnonymousDecember 26, 2025Verified Purchase
Throw Pillow, 16" Throw Pillow
Turned out much better than expected. The picture was 47 years old. Upload the actual pillow picture, very happy with finished product. The customer service is exemplary as well. Very Highly recommend.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Sonja C.July 6, 2016Verified Purchase
Throw Pillow, 16" Throw Pillow
Zazzle Reviewer Program
It was fun to be able to personalize it for the couple. It fit the theme of the bridal shower. My daughter was thrilled when she saw it. I had cleaned up and spray painted a wicker chair for her to sit on during the shower and this pillow was placed on it as a special touch. It drew a lot of attention from the guests. It was great! Printing was crisp and exactly as I personalized it. It was a perfect piece for the shower.

Tags

Pillows
mr and mrsgiftkeepsakenewlywedsscriptjust marriedelegantcouples giftweddinganniversary
All Products
mr and mrsgiftkeepsakenewlywedsscriptjust marriedelegantcouples giftweddinganniversary

Other Info

Product ID: 256765352674582625
Created on: 8/7/2025, 5:15 AM
Rating: G