Tap / click on image to see more RealViewsTM
Sale Price $22.44.  
Original Price $28.05 Comp. value
per mug
You save 20%

Mug-Buck Coffee Mug

Qty:
Classic Mug
+$1.45
+$2.80
+$6.90
+$8.25
+$12.75
+$19.75

Other designs from this category

About Mugs

Sold by

Style: Classic Mug

Give a made-to-order mug from Zazzle to someone special, or treat yourself to a design that brings you joy or makes you laugh. Create your own photo mug, shop our collection of the funniest joke mugs, personalize your mug with a monogram, or express yourself with one of our 10 million designs.

  • Available in 11-ounce or 15-ounce
  • Dimensions:
    • 11-ounce: 3.2” D x 3.8” H
    • 15-ounce: 3.4” D x 4.5” H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Printed on demand in Reno, NV
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Mug-Buck Coffee Mug

Mug-Buck Coffee Mug

Vintage image courtesy of Wikimedia Commons, public domain images...create on your choice of any mug. Composed in Photoshop

Customer Reviews

4.8 out of 5 stars rating22K Total Reviews
19381 total 5-star reviews1845 total 4-star reviews335 total 3-star reviews152 total 2-star reviews237 total 1-star reviews
21,950 Reviews
Reviews for similar products
5 out of 5 stars rating
By R.May 16, 2020Verified Purchase
Classic Mug, 11 oz
Zazzle Reviewer Program
Got a personalized coffee mug for my husband as a birthday gift from our kids. He lovessss it!! Turned out really nice! The pictures were really clear!! Great product!! The pictures were really clear!!! They turned out great!!
5 out of 5 stars rating
By Maureen Z.May 8, 2022Verified Purchase
Classic Mug, 11 oz
Zazzle Reviewer Program
It is a lovely mug. The actual mug is shiny and smooth. Very nice quality. It was everything I expected. Zazzle has so many nice mid century modern designs to choose from. All so pretty! The design was very clear and looked expensive.
5 out of 5 stars rating
By A.October 19, 2021Verified Purchase
Two-Tone Mug, 11 oz
Zazzle Reviewer Program
I love the mug, it is Awesome looking! 😊 I bought this mug to give to my uncle for Christmas. He has a 57 Chevy that is the same color as this 57 Chevy on this mug. He's going to love this mug! 😊 Thank You So Much!!! 😊. Awesome Mug!!! The printing of the 57 Chevy looks Awesome!!! 😊

Tags

Mugs
deerbuckswildlifeanimalsgiftsvintagemugs
All Products
deerbuckswildlifeanimalsgiftsvintagemugs

Other Info

Product ID: 168029996757539293
Created on: 9/27/2012, 11:41 AM
Rating: G