Tap / click on image to see more RealViewsTM
Sale Price $23.80.  
Original Price $28.00 Comp. value
per mug
You save 15%

Mug-Buck Coffee Mug

Qty:
Classic Mug
+$1.40
+$2.75
+$6.90
+$8.25
+$11.00
+$13.75

Other designs from this category

About Mugs

Sold by

Style: Classic Mug

Give a made-to-order mug from Zazzle to someone special, or treat yourself to a design that brings you joy or makes you laugh. Create your own photo mug, shop our collection of the funniest joke mugs, personalize your mug with a monogram, or express yourself with one of our 10 million designs.

  • Available in 11-ounce or 15-ounce
  • Dimensions:
    • 11-ounce: 3.2” D x 3.8” H
    • 15-ounce: 3.4” D x 4.5” H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Printed on demand in Reno, NV
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Mug-Buck Coffee Mug

Mug-Buck Coffee Mug

Vintage image courtesy of Wikimedia Commons, public domain images...create on your choice of any mug. Composed in Photoshop

Customer Reviews

4.8 out of 5 stars rating21.8K Total Reviews
19299 total 5-star reviews1841 total 4-star reviews333 total 3-star reviews143 total 2-star reviews229 total 1-star reviews
21,845 Reviews
Reviews for similar products
5 out of 5 stars rating
By R.May 16, 2020Verified Purchase
Classic Mug, 11 oz
Zazzle Reviewer Program
Got a personalized coffee mug for my husband as a birthday gift from our kids. He lovessss it!! Turned out really nice! The pictures were really clear!! Great product!! The pictures were really clear!!! They turned out great!!
5 out of 5 stars rating
By Maureen Z.May 8, 2022Verified Purchase
Classic Mug, 11 oz
Zazzle Reviewer Program
It is a lovely mug. The actual mug is shiny and smooth. Very nice quality. It was everything I expected. Zazzle has so many nice mid century modern designs to choose from. All so pretty! The design was very clear and looked expensive.
5 out of 5 stars rating
By Mason I.July 11, 2020Verified Purchase
Classic Mug, 15 oz
Creator Review
This design is full of browns, pinks, turquoise and more. Very contemporary with vivid geometric triangle shapes. Looks really great with our Mexican tile tables. Really stunning, modern pattern! The lines for each triangle are perfect. The colors are vivid and pop. Great Printing.

Tags

Mugs
deerbuckswildlifeanimalsgiftsvintagemugs
All Products
deerbuckswildlifeanimalsgiftsvintagemugs

Other Info

Product ID: 168029996757539293
Created on: 9/27/2012, 11:41 AM
Rating: G