Tap / click on image to see more RealViewsTM
Sale Price $324.92.  
Original Price $382.25 Comp. value
per print set
You save 15%

one line woman and leaf wall art set

by
Qty:
18"x24"
Silver Metal Frame (7/8" wide)
-$42.00
-$42.00
-$42.00
-$42.00
-$42.00
Inset Faux White Mat
+$40.95
+$40.95

Other designs from this category

About Print Sets

Sold by

Set Size: Set of 2

This custom Print Set is your personal art gallery! Display your favorite photos of your loved ones, special moments, or personal designs and artwork. Whether you're looking to create a gallery wall or just add a touch of elegance to a single room, our Print Sets are the perfect solution. Show off your unique style with this personalized addition to your home decor.
  • Choice of set sizes: 2, 3, or 4 prints
  • 10 standard sizes to choose from
  • Printed on quality paper for long-lasting memories
  • 3 wooden frame options available, with the option of borders and matting
  • With frames selected they’re ready to hang for easy and convenient display
  • Borders and matting options may vary based on selected frame and print size
  • Frames include Non-Glare Acrylic Glazing

About This Design

one line woman and leaf wall art set

one line woman and leaf wall art set

Transform your space with this elegant set of two abstract wall art prints, featuring minimalist one-line drawings. Each print in the set presents a unique blend of fluid lines, showcasing a female figure intertwined with a delicate leaf motif. These artworks embody the essence of simplicity and grace, making them perfect for those who appreciate modern and sophisticated decor. Printed on premium-quality paper, these versatile pieces are ideal for adding a stylish and artistic touch to any room, whether it’s a living room, bedroom, or office. Enhance your decor with this timeless set that brings both tranquility and beauty to your walls.

Customer Reviews

There are no reviews for this product yet.Have you purchased this product?

Tags

Print Sets
bohoabstractminimalfemaletrendysketchwomanone line art drawingwall art sethome
All Products
bohoabstractminimalfemaletrendysketchwomanone line art drawingwall art sethome

Other Info

Product ID: 256072679131070398
Created on: 8/26/2024, 8:38 AM
Rating: G