Tap / click on image to see more RealViewsTM
Sale Price $39.96.  
Original Price $49.95 Comp. value
per wallpaper roll
You save 20%

Pastel Elegant Pink Grey Stripe Floral Wallpaper

Qty:

Other designs from this category

About Wallpapers

Sold by

Style: Textured vinyl

Introducing our Peel and Stick Wallpaper, a game-changer for effortless room transformations. This high-quality wallpaper features a matte finish and a hassle-free peel-and-stick application, making it a breeze to revamp your living spaces. Choose from textured vinyl or smooth vinyl and six different sizes, including a swatch so you can test the application, and find that perfect fit, ranging from small accent walls to large room makeovers.

  • Easy Maintenance: The wallpaper's smooth surface allows for easy cleaning and maintenance, making it perfect for busy households or high-traffic areas.
  • Residue-free Removal: When it's time for a change, our wallpaper can be easily removed without leaving any residue or damaging your walls, allowing for a hassle-free transition.
  • Versatile Design Options: Choose from a wide range of captivating designs, patterns, and colors to suit your personal style and enhance the ambiance of any room.
  • DIY-Friendly: Our Peel and Stick Wallpaper is designed for easy DIY installation, making it accessible to anyone. No professional skills or tools are required, saving you time and money.
  • Need some help hanging your wallpaper? Please check out our how-to guide here

About This Design

Pastel Elegant Pink Grey Stripe Floral Wallpaper

Pastel Elegant Pink Grey Stripe Floral Wallpaper

Pink Grey Stripe Floral Wallpaper. Express yourself with some fun Peel and Stick Wallpaper! Our print-on-demand custom wallpaper is here to redefine your space. This product would be perfect for Renters, DIY Enthusiasts, Homeowners, College students, Parents and Interior Designers! Transform spaces with ease and style, offering a seamless blend of functionality and design. For a custom order, do not place this item in your cart. Instead, message me your request. A link to your item will be emailed to you once the item is available. You can use that link to place your order. Please allow up to 24 hours.

Customer Reviews

4.0 out of 5 stars rating6 Total Reviews
4 total 5-star reviews0 total 4-star reviews1 total 3-star reviews0 total 2-star reviews1 total 1-star reviews
6 Reviews
Reviews for similar products
5 out of 5 stars rating
By Suzanne R.September 18, 2025Verified Purchase
Custom Wallpaper 2' x 4', Textured vinyl
Great xxxxxxxccc. Yuyyyyyyyyyyyyyyyyyy.
5 out of 5 stars rating
By Charles K.August 15, 2025Verified Purchase
Custom Wallpaper 2' x 4', Textured vinyl
It is fabulous! Am always excited to show others. It is dramatic!!
3 out of 5 stars rating
By AnonymousJuly 3, 2025Verified Purchase
Custom Wallpaper 2' x 4', Textured vinyl
Need a lot to complete a small space because the lobster is all have to line up perfectly from peace to peace. I’ve already spent $600 and I need to order two more rolls in order to cover a very small space the size of a closet. The product has nice quality however the price is a little unreasonable for the sizes that they offer. I still will have to buy three more rolls that will make this almost $1000 project.

Tags

Wallpapers
customwallpaperpeelstickwallpaperremovablewallpapertrendydormdecordesignerwallpaperhomedecorfloralwallpapergirlwallpaperpinkgreyfloralstripe
All Products
customwallpaperpeelstickwallpaperremovablewallpapertrendydormdecordesignerwallpaperhomedecorfloralwallpapergirlwallpaperpinkgreyfloralstripe

Other Info

Product ID: 256676495431015237
Created on: 8/12/2024, 10:14 AM
Rating: G