Tap / click on image to see more RealViewsTM
Sale Price $7.14.  
Original Price $8.40 Comp. value
per sheet of 20
You save 15%

Pastel Pink Monogram Sticker – Custom Design

Qty:
Classic Round Stickers
+$0.35
+$0.35
+$0.35

Other designs from this category

About Stickers

Sold by

Shape: Classic Round Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 3" diameter, 6 stickers per sheet
    • Small: 1.5" diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-color, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Pastel Pink Monogram Sticker – Custom Design

Pastel Pink Monogram Sticker – Custom Design

"Add a touch of elegance to your belongings with this personalized pastel pink monogram sticker. Featuring a soft blush background and a minimalist initial design, this sticker is perfect for customizing laptops, notebooks, water bottles, and more. The high-quality vinyl ensures durability, while the adhesive is strong yet removable, making it easy to reposition without leaving residue."

Customer Reviews

4.8 out of 5 stars rating26.5K Total Reviews
22981 total 5-star reviews2172 total 4-star reviews548 total 3-star reviews333 total 2-star reviews497 total 1-star reviews
26,531 Reviews
Reviews for similar products
5 out of 5 stars rating
By AnonymousOctober 19, 2025Verified Purchase
Custom Classic Round Stickers, Format: Sheet of Stickers, Size: Small, 1½ inch (sheet of 20), Paper Type: Glossy White Paper
I have reordered these now 3 times for my small business because they come in so fast and the quality is just absolutely unmatched. Will continue to repurchase for a LONG time!
5 out of 5 stars rating
By Kathleen M.April 29, 2024Verified Purchase
Custom Classic Round Stickers, Format: Sheet of Stickers, Size: Small, 1½ inch (sheet of 20), Paper Type: Glossy White Paper
These were easy to order and came well ahead of the date. They are high qualify labels that peel easily and looked as advertised online. These labels perfectly matched with the "rustic" theme for my niece's bridal shower. I made "cowgirl cookies" and put these labels on the jars. Everyone loved the jars!
5 out of 5 stars rating
By Donna M.January 26, 2026Verified Purchase
Custom Classic Round Stickers, Format: Sheet of Stickers, Size: Small, 1½ inch (sheet of 20), Paper Type: Glossy White Paper
Loved these stickers. Colors are great…size 1 1/2” was perfect for many items at my baby shower. Stickie is great as well. I could easily reposition if needed. Highly recommend. Fast service too.

Tags

Stickers
personalizedstickermonogramcustominitialpastelpinkminimalistvinyldecal
All Products
personalizedstickermonogramcustominitialpastelpinkminimalistvinyldecal

Other Info

Product ID: 256529118571070265
Created on: 4/15/2025, 1:55 AM
Rating: G