Tap / click on image to see more RealViewsTM
Sale Price $69.62.  
Original Price $81.90 Comp. value
per tree skirt
You save 15%

Periwinkle Blue Damask Old World Gold Brushed Polyester Tree Skirt

Qty:
Brushed Polyester

Other designs from this category

About Tree Skirts

Sold by

Fabric: Tree Skirt (Brushed Polyester)

You take the time to decorate the top of your tree, but what about the bottom? Polish off your tree and set the stage for your presents with this fun & fully customizable tree skirt. This brushed polyester tree skirt delivers beautiful print quality that will be the perfect finishing touch for your festive holiday décor.

  • Dimensions: 44"diameter
  • Material: 100% brushed polyester
  • Placed flat, tree stump opening is 12"
  • Easy closure, no snaps or ties to worry about
  • Designed to fit most trees
  • Machine washable, lay flat to dry
  • Made in USA

About This Design

Periwinkle Blue Damask Old World Gold  Brushed Polyester Tree Skirt

Periwinkle Blue Damask Old World Gold Brushed Polyester Tree Skirt

Periwinkle Blue Damask Old World Gold tree skirt tree skirt Periwinkle Blue Damask Old World Gold tree skirt, damask motif element, in repeat half drop pattern, created by Kristie Hubler. Has sold on many home decor table linen textiles! Thank you! Kristie Hubler https://zazzle.com/store/fabricatedframes/products fabricatedframescom at gmail dot com

Customer Reviews

4.4 out of 5 stars rating83 Total Reviews
55 total 5-star reviews15 total 4-star reviews7 total 3-star reviews2 total 2-star reviews4 total 1-star reviews
83 Reviews
Reviews for similar products
5 out of 5 stars rating
By Debbie C.November 28, 2018Verified Purchase
Tree Skirt, Brushed Polyester
Zazzle Reviewer Program
I had been looking for something like this for almost a year. I decided to try to do a Puppy Christmas theme last January and searched for things all through the year. This tree skirt was the last thing I had not found til I found your site. When I found this, I was so excited. It came quite quickly. It is such a nice tree skirt and very well made. I couldn't have asked for a better product! Thank you so much. It is just perfect. I knew what I wanted, but couldn't put it into words or a pic. Your printing and the actual saying fit right in with my theme.
5 out of 5 stars rating
By Paulette C.December 9, 2019Verified Purchase
Tree Skirt, Brushed Polyester
Zazzle Reviewer Program
This looks great and was the finishing touch to our Christmas tree. I am very happy with this and would highly recommend it. We had it printed with the H on it. It looks just like the picture.
5 out of 5 stars rating
By Roberta M.November 29, 2024Verified Purchase
Tree Skirt, Brushed Polyester
Love this tree skirt. Love all products from Retro Christmas. Diane Dempsey. Highly recommend her products.

Tags

Tree Skirts
damaskold worldmediterraneanitalianspanishvintageperiwinklegoldtree skirt
All Products
damaskold worldmediterraneanitalianspanishvintageperiwinklegoldtree skirt

Other Info

Product ID: 256919589950071043
Created on: 10/8/2022, 12:27 AM
Rating: G