Tap / click on image to see more RealViewsTM
Sale Price $34.20.  
Original Price $40.20. Comp. value
Sale Price $2.85per drink mix pack.
You save 15%

Periwinkle & White Modern Minimalist Wedding Lemonade Drink Mix

Wedding Collection
Qty:

Other designs from this category

Shop this wedding suite

 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

About Drink Mixes

Sold by

Style: Lemonade Drink Mix

Tingle friends’ and family’s taste buds with a deliciously refreshing treat. Personalized lemonade favors guarantee the taste of summer with every sweet sip! A bit of sparkling sunshine in a glass, loved ones won’t be able to resist these fresh and fun favors. Saying “thank you” just keeps getting sweeter and sweeter!

  • Proudly made in the USA
  • Single serving of premium drink mix
  • Comes sealed in a beautiful white gloss pouch
  • Instructions are on the back on how to mix the pouch contents with other ingredients to create a delicious drink
  • Great For Gifts and Favors
  • Easily self assembled with self-adhesive labels
  • Purchase pre-assembled for an upcharge
  • Dimensions: 4"w x 5.5"h

Nutrition Facts: Serving Size: 1oz (28g), Servings Per Packet: 1, Amount Per Serving: Calories 98, Calories from Fat 0, Total Fat 0g (0%DV), (Saturated Fat 0g (0%DV), Trans Fat 0g, Cholesterol 0mg (0%DV), Sodium (45mg (2%DV), Total Carbohydrate 26g (9%DV), Dietary Fiber 0g (0%DV), Sugars 26g, Protein 0g. Not a significant source of vitamin A, vitamin C, Calcuim, & Iron. Percent Daily Values (DV) are based on a 2.000 calorie diet.
INGREDIENTS: SUGAR. CITRIC ACID, GUM ARABIC. XANTHAN GUM.TRI-CALCIUM PHOSPHATE. NATURAL AND ARTIFICIAL FLAVORS. SILICONE DIOXIDE. ARTIFICIAL COLORS, YELLOW #5, YELLOW #6.

About This Design

Periwinkle & White Modern Minimalist Wedding  Lemonade Drink Mix

Periwinkle & White Modern Minimalist Wedding Lemonade Drink Mix

Pretty, modern, minimalist and trendy wedding design features 2022 color palette of periwinkle blue background with white customizable text blocks in modern fonts

Customer Reviews

4.9 out of 5 stars rating7 Total Reviews
6 total 5-star reviews1 total 4-star reviews0 total 3-star reviews0 total 2-star reviews0 total 1-star reviews
7 Reviews
Reviews for similar products
5 out of 5 stars rating
By Chrissy F.April 14, 2026Verified Purchase
Custom Lemonade Drink Mix, Non-Assembled
Initially I was looking for tea as one of my wedding party favors, but noticed this incredibly clever, beautiful sticker design by Briana McMahon and decided lemonade mix was a must. The “perfect mix” quote, soft blue color tones, font choice, the lemony illustration looks like a million bucks! Customization on Zazzle is easy to do and user-friendly. Ordering is straightforward and most likely you may find discount codes through their emails or online. Shipping was free thanks to the premium membership. The product itself was packed in a nice, organized fashion and the printed stickers came out great. When I got my shipment, a few weeks later I was finally ready to assemble the mixes and tea but noticed instead of lemonade, it read “margarita mix”..no biggie mistake happen..it was so easy to find customer service due to Zazzle sending emails asking about the product. Fiona, Niomi, and the Zazzle team ensured I got my correct product in a matter of a week and a half! Blown away by the customer service support…They included a few more stickers so with the extra I can add to another brand of lemonade mix. As far as the margarita mix, I designed my own sticker and will get printed. Many praises for Zazzle in being a key resource in my wedding planning! .
5 out of 5 stars rating
By Nancy B.April 11, 2023Verified Purchase
Custom Tea, Non-Assembled
Zazzle Reviewer Program
So so cute! Cannot wait to show all my friends! So easy to assemble .
5 out of 5 stars rating
By Nancy B.April 11, 2023Verified Purchase
Custom Tea, Non-Assembled
Zazzle Reviewer Program
Absolutely adorable! Can’t wait to share them. Perfect for my daughters coffee/tea themed shower!!

Tags

Drink Mixes
modern minimalistprettytrendyperiwinklebluepurple2022 color palettesimplewhitewedding favors
All Products
modern minimalistprettytrendyperiwinklebluepurple2022 color palettesimplewhitewedding favors

Other Info

Product ID: 256442376226693893
Created on: 2/16/2022, 7:35 AM
Rating: G