Tap / click on image to see more RealViewsTM
Sale Price $2.89.  
Original Price $3.40 Comp. value
per sticker
You save 15%

Personalized Pink Modern Magical Unicorn Sticker

4.5 out of 5 stars rating
1118 Total Reviews |
by
Collection
Qty:
Sticker Sheet Size
Paper Type

Other designs from this category

Shop this collection

Wind-Up Sprout
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

About Custom-Cut Vinyl Stickers

Sold by
Custom-Cut Vinyl StickerCreate your own from scratch

Sticker Sheet Size: 3" x 3" Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 3" L x 3.5" W
  • Design Area: 3" L x 3" W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.125" border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Personalized Pink Modern Magical Unicorn Sticker

Personalized Pink Modern Magical Unicorn Sticker

This product design features a contemporary unicorn illustration with bubbles and the word, Magical. The mythological animal illustration in white and light rose pink makes a modern and unique vinyl sticker with personalized text for girl.
Wind-up Sprout Design
Pro
Artwork designed by
United States
View their Store

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
902 total 5-star reviews67 total 4-star reviews27 total 3-star reviews32 total 2-star reviews90 total 1-star reviews
1,118 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Aurelia T.May 5, 2022 • Verified Purchase
14" x 14" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was able to give us a designer the dimensions of my mini shot glasses and she was able to reduce all the labels onto one sheet we’re all I did was going to change the names and add the table number for my seating chart absolutely perfect. Simple perfect easy to read fit great on my jar
5.0 out of 5 stars rating
5 out of 5 stars rating
By Nichole M.August 9, 2020 • Verified Purchase
8" x 8" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These turned out so beautifully and all our guests loved them!! They did not have the orange suit sleeves so I ordered them separately and they fit perfectly into the mailing envelope. I had an issue with the address labels not being ledge able and they redid them and replaced them. They are perfect!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jenn K.August 20, 2019 • Verified Purchase
6" x 6" Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
Good quality vinyl stickers that stick well but also can be removed without residue. Funny eyes for all sorts of stuff. Printing turned out great and looks just as it appears online.

Tags

Custom-Cut Vinyl Stickers
magicalunicornmodernnamefantasykidspinkgirlwhimsicalcute
All Products
magicalunicornmodernnamefantasykidspinkgirlwhimsicalcute

Other Info

Product ID: 256161520697003702
Created on: 1/25/2022, 5:23 PM
Rating: G 
Related Searches
magical unicorn glitter stickersunicorn stickersunicorn birthday stickersunicorn thank you stickerscat unicorn stickers