Tap / click on image to see more RealViewsTM
Sale Price $72.00.  
Original Price $84.60. Comp. value
Sale Price $6.00per hershey's chocolate bars (1.55 oz.).
You save 15%

Personalized Pink Sweet 16 Hershey Bar Favors

Qty:

Other designs from this category

About Hershey's Chocolate Bars (1.55 oz.)s

Sold by

Style: Hershey's Chocolate Bars (1.55 oz.)

Indulge your guest’s senses with personalized creamy and smooth Hershey®'s Milk Chocolate Bar favors. Chocolate is always a pleaser that suits everyone's tastes. These are favors that will definitely not be left behind and are sure to sweeten your guest's day.

  • Proudly made in the USA.
  • Standard 1.55 oz Hershey's Milk Chocolate Bar
  • Great For Gifts and Favors
  • The Sweetest Favors for your Special Day
  • Dimensions: Hershey's Bar 5.5"w x 2.25"h
  • Kosher ⓊD
  • Store at room temperature
Assembly Steps:
  • Place your personalized wrapper face down. Next, put the front of your Hershey's bar face down in the center of the personalized wrapper.
  • Using a non-toxic glue stick, glue the bottom edge of the wrapper from one end to the other end and 1/4 way up the center.
  • Fold the top of the personalized wrapper over the top of the bar creating a little flap and hold it there.
  • Fold the glued bottom wrapper over top of the flap.
  • Press firmly across the wrapper to glue the entire area from left to right.

Please note: our chocolate is shipped within its expiration dates. In the case there is white or gray discoloration and a grainy texture this is due to a process called Chocolate Bloom, which is a non-harmful occurrence that can occasionally happen with chocolate in transit, due to changes of temperature. Most importantly, your chocolate is still safe to consume.

Nutritional Information:
Serving Size: 43 g
Serving Per Container: 1
Amount Per Serving:
    Calories: 220
    Total Fat 13g (17% Daily Value *)
    Saturated Fat 8g (40%)
    Trans Fat 0g
    Cholesterol 10mg (4%)
    Sodium 35mg (2%)
    Total Carbohydrate 26g (10%)
    Dietary Fiber 1g (4%)
    Sugars 25g
    Added Sugars 21g (43%)
    Protein 3g
    Potassium (4%)
    Vitamin D (4%)
    Calcium (6%)
    Iron (8%)
* Percentage of Daily Values are based on a 2,000 calorie diet.
Ingredients: Milk Chocolate [Sugar; Milk; Chocolate; Cocoa Butter; Milk Fat; Lecithin (Soy);

About This Design

Personalized Pink Sweet 16 Hershey Bar Favors

Personalized Pink Sweet 16 Hershey Bar Favors

Minimalist pink number 16 for her Sweet Sixteen or 16th birthday. Change the colors or number to another milestone birthday. Create your own girly name birthday candy bar favors.

Customer Reviews

4.9 out of 5 stars rating8 Total Reviews
7 total 5-star reviews1 total 4-star reviews0 total 3-star reviews0 total 2-star reviews0 total 1-star reviews
8 Reviews
Reviews for similar products
4 out of 5 stars rating
By Theresa R.July 31, 2025Verified Purchase
Custom Hershey's Chocolate Bars (1.55 oz.), nonassembled
The labels and silver packaging were great. The ice back was melted and several chocolates were melted and broken. .
5 out of 5 stars rating
By Mathew M.May 17, 2025Verified Purchase
Custom Hershey's Chocolate Bars (1.55 oz.), nonassembled
Turned out so cute! Putting them in welcome bags for my daughters wedding!!
5 out of 5 stars rating
By Chandra R.November 9, 2025Verified Purchase
Custom Hershey's Chocolate Bars (1.55 oz.), nonassembled
Excellent quality the delivery of the candy bars was top of the line very secure the candy bars were on ice I enjoyed the way they were packaged will definitely order again.

Tags

Hershey's Chocolate Bars (1.55 oz.)s
16th birthdaysweet sixteensweet 16 party celebrationpinkfemininegirlystylecalligraphy signaturetypographymodern minimalist
All Products
16th birthdaysweet sixteensweet 16 party celebrationpinkfemininegirlystylecalligraphy signaturetypographymodern minimalist

Other Info

Product ID: 256839569004669702
Created on: 3/20/2025, 9:34 PM
Rating: G