Tap / click on image to see more RealViewsTM
Sale Price $15.60.  
Original Price $19.50 Comp. value
per compact mirror
You save 20%

Personalized Purple Lilacs Mirror For Makeup

Qty:
Oval

Other designs from this category

About Compact Mirror

Sold by

Shape: Oval Compact Mirror

Customize a compact mirror for stylish touch-ups on the go! Available in four fun shapes, this luxurious compact mirror is a one-of-a-kind accessory that fits perfectly in your purse.

  • Dimensions: 2.3"l x 2.8"w x 0.4"h
  • Design printed in vibrant color on metal insert on front of compact mirror
  • All-metal contruction, inside mirrors on both sides
This product is recommended for ages 13+.

About This Design

Personalized Purple Lilacs Mirror For Makeup

Personalized Purple Lilacs Mirror For Makeup

Lilac flowers in beautiful shades of lavender, purple and periwinkle. An elegant damask motif embellishes the left side. The background is a soft lavender. Personalize this compact mirror with a name or monogram. They great to hand out as bridal wedding party favors or gifts.

Customer Reviews

4.8 out of 5 stars rating355 Total Reviews
296 total 5-star reviews40 total 4-star reviews12 total 3-star reviews4 total 2-star reviews3 total 1-star reviews
355 Reviews
5 out of 5 stars rating
By Carol D.December 22, 2017Verified Purchase
Oval Compact Mirror
Zazzle Reviewer Program
This compact, personalized with my co-worker's name made her happy. It is perfect for those people who you have a spending limit, but want something special. Very nice. The font is lovely and they got her name correct. She commented "you even remembered the hyphen."!
Reviews for similar products
5 out of 5 stars rating
By Carolyn W.May 12, 2015Verified Purchase
Round Compact Mirror
Creator Review
This product is beautiful and just as described. It came in a little box inside a padded envelope, and I expected a smashed mirror, but it's perfect! Thank you! The printing is flawless, and the moon and stars image looks great!
5 out of 5 stars rating
By Maria P.June 3, 2022Verified Purchase
Square Compact Mirror
Zazzle Reviewer Program
I use my daughter‘s art and I have made many of these as gifts. The quality is amazing and the colors are perfectly done. I was very happy. Colors were perfect!

Tags

Compact Mirror
purplelavenderlilaclilacsdamaskflowerflowersfloralpersonalizedname
All Products
purplelavenderlilaclilacsdamaskflowerflowersfloralpersonalizedname

Other Info

Product ID: 256760420358941087
Created on: 2/6/2015, 10:55 AM
Rating: G