Tap / click on image to see more RealViewsTM
Sale Price $38.50.  
Original Price $45.00. Comp. value
Sale Price $0.77per candy.
You save 15%

Personalized White & Gold Chic Minimal Wedding Reese's Peanut Butter Cups

Qty:

Other designs from this category

About Hershey's Candy Favorss

Sold by

Style: Reese's Miniatures Milk Chocolate Peanut Butter Cups

The perfect blend of peanut butter and creamy milk chocolate find themselves perfectly packaged, individually wrapped and personalized making them a simply scrumptious party favor, for everyone... anytime... any occasion! It's hard to eat just one Reese's Peanut Butter Cups Miniatures!

  • Proudly made in the USA
  • Great For Gifts and Favors
  • The Sweetest Favors for your Special Day
  • Easily self assembled with self-adhesive labels
  • Purchase pre-assembled for an upcharge
  • Dimensions: 1.25"w x .75"h
  • Suggested quantity per guest: 5-10
  • Kosher ⓊD
  • Store at room temperature
  • Allergy Information: Hershey's Reese's Peanut Butter Cups Miniatures contain peanuts. For complete information regarding any Hershey's products, please contact The Hershey Company

Please note: our chocolate is shipped within its expiration dates. In the case there is white or gray discoloration and a grainy texture this is due to a process called Chocolate Bloom, which is a non-harmful occurrence that can occasionally happen with chocolate in transit, due to changes of temperature. Most importantly, your chocolate is still safe to consume.

Nutrition Facts
about 39 servings per container
Serving size 3 pieces (26g)
Amount per serving
Calories 130
Total Fat
7g, 10% (% Daily Value*)
Saturated Fat 3g, 15%
Trans Fat 0g
Cholesterol <5mg, 1%
Sodium 80mg, 3%
Total Carbohydrate 15g, 6%
Dietary Fiber <1g, 3%
Total Sugars 14g
Includes 13g Added Sugars, 26%
Protein 3g

Vitamin D 0.1mcg, 0% Calcium 30mg, 2%
Iron 0.7mg, 4%
Potassium 90mg, 2%

*The % Daily Value tells you how much a nutrient in a serving of food contributes to a daily diet. 2,000 calories a day is used for general nutrional advice.

INGREDIENTS: MILK CHOCOLATE [SUGAR: COCOA BUTTER: CHOCOLATE; SKIM MILK: MILK FAT: LACTOSE, LECITHIN (SOY); PGPR]: PEANUTS: SUGAR; DEXTROSE; SALT: TBHQ AND CITRIC ACID, TO MAINTAIN FRESHNESS.

About This Design

    Personalized White & Gold Chic Minimal Wedding Reese's Peanut Butter Cups

Personalized White & Gold Chic Minimal Wedding Reese's Peanut Butter Cups

Personalize these elegant favors with your names and wedding date. Colors of this modern and elegant design : gold and white.

Customer Reviews

4.1 out of 5 stars rating18 Total Reviews
9 total 5-star reviews5 total 4-star reviews2 total 3-star reviews0 total 2-star reviews2 total 1-star reviews
18 Reviews
Reviews for similar products
5 out of 5 stars rating
By Elizaverg G.April 29, 2024Verified Purchase
came out super cute for a favor for my wedding! clear and vibrant colors
5 out of 5 stars rating
By Dana B.August 13, 2023Verified Purchase
Hershey®'s Kisses® Candy Favors, Non-Assembled
Zazzle Reviewer Program
These personalized Kisses are the perfect add to my son's wedding guest gift boxes! They arrived on time packed in a styrofoam cooler with with an ice pack, alleviating my worries of not being home to bring them inside immediately from the Oklahoma summer heat! Thank you, Zazzle! Perfect image of the picture I uploaded of the bride and groom!
5 out of 5 stars rating
By Katherine C.October 4, 2022Verified Purchase
Hershey’s Reese's Peanut Butter Cups Minatures Candy Favors, Assembled
Zazzle Reviewer Program
This is a great product. I ordered these customizable reese's minis for my upcoming wedding as part of the gift bag we're giving to attendees. The design came out great, the delivery was timely, and of course the end product was also delicious. I recommend this product for parties, events, or just for fun. You can probably still order them in time for Halloween, too, if you want a customizable candy to dole out come the 31st of this month :). Printing was great. Photo was clear, so was text.

Tags

Hershey's Candy Favorss
elegantmodernweddinggoldluxuryvintagewhiteminimalclassysimple
All Products
elegantmodernweddinggoldluxuryvintagewhiteminimalclassysimple

Other Info

Product ID: 256992896378447082
Created on: 3/28/2022, 4:40 AM
Rating: G