Tap / click on image to see more RealViewsTM
Sale Price $11.92.  
Original Price $14.90 Comp. value
per sticker
You save 20%

PIGS STICKER

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Extra-Large 14" x 14" Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 14" L x 14.5" H
  • Design Area: 14" L x 14" H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof and scratch-resistant
  • Available in 6 sizes
  • 0.125" border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

PIGS STICKER

PIGS STICKER

Darn cute. Look for our other "PIGS" merch.

Customer Reviews

4.8 out of 5 stars rating11 Total Reviews
10 total 5-star reviews0 total 4-star reviews1 total 3-star reviews0 total 2-star reviews0 total 1-star reviews
11 Reviews
Reviews for similar products
5 out of 5 stars rating
By Marie S.June 1, 2021Verified Purchase
Medium 6" x 6" Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
Looks great! A variety of bright color designs for fun and whimsy. Gift for a book loving sister who gave me (the artist) lots of feedback on the design. These are Custom-Cut Vinyl Sticker and low tack ~ very cool! Very pleased. It comes with a choice of each sticker with a white outline. In hindsight the clear option would have been preferred but depends on it's placement too. Fun!
5 out of 5 stars rating
By Alaenya H.January 13, 2022Verified Purchase
Extra-Small 3" x 3" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
My niece was born in AZ and she wanted a sticker for her water bottle from where she was born. She loved this design. The image quality was beautiful!
5 out of 5 stars rating
By Melanie B.August 18, 2021Verified Purchase
Medium 6" x 6" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
The sticker material is quite thick and durable. I would compare the quality to a typical vinyl bumper sticker. Not easy to scratch but definitely able to tear if you peel it off too quickly. Color match for a specific shade of red was perfect! The logo looks a tad blurry but that's likely because the original image I uploaded was not of the best quality. Would highly recommend uploading a vectorized image rather than pixelated if you're looking for sharp lines.

Tags

Custom-Cut Vinyl Stickers
pigsflystickerwingsangelsarcasmhumorlaughs
All Products
pigsflystickerwingsangelsarcasmhumorlaughs

Other Info

Product ID: 256893149069550397
Created on: 5/27/2019, 2:21 PM
Rating: G