Tap / click on image to see more RealViewsTM
Sale Price $13.41.  
Original Price $14.90 Comp. value
per sticker
You save 10%

PIGS STICKER

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Extra-Large 14" x 14" Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 14" L x 14.5" W
  • Design Area: 14" L x 14" W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.125" border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

PIGS STICKER

PIGS STICKER

Darn cute. Look for our other "PIGS" merch.

Customer Reviews

4.8 out of 5 stars rating11 Total Reviews
10 total 5-star reviews0 total 4-star reviews1 total 3-star reviews0 total 2-star reviews0 total 1-star reviews
11 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Marie S.June 1, 2021Verified Purchase
Medium 6" x 6" Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
Looks great! A variety of bright color designs for fun and whimsy. Gift for a book loving sister who gave me (the artist) lots of feedback on the design. These are Custom-Cut Vinyl Sticker and low tack ~ very cool! Very pleased. It comes with a choice of each sticker with a white outline. In hindsight the clear option would have been preferred but depends on it's placement too. Fun!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Alaenya H.January 13, 2022Verified Purchase
Extra-Small 3" x 3" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
My niece was born in AZ and she wanted a sticker for her water bottle from where she was born. She loved this design. The image quality was beautiful!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Melanie B.August 18, 2021Verified Purchase
Medium 6" x 6" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
The sticker material is quite thick and durable. I would compare the quality to a typical vinyl bumper sticker. Not easy to scratch but definitely able to tear if you peel it off too quickly. Color match for a specific shade of red was perfect! The logo looks a tad blurry but that's likely because the original image I uploaded was not of the best quality. Would highly recommend uploading a vectorized image rather than pixelated if you're looking for sharp lines.

Tags

Custom-Cut Vinyl Stickers
pigsflystickerwingsangelsarcasmhumorlaughs
All Products
pigsflystickerwingsangelsarcasmhumorlaughs

Other Info

Product ID: 256893149069550397
Created on: 5/27/2019, 2:21 PM
Rating: G