Tap / click on image to see more RealViewsTM
The lace and rose gold elements are simulated in the artwork by the Creator. These elements will not be used in the making of this product.Browse real foil products
Sale Price $35.04.  
Original Price $43.80. Comp. value
Sale Price $2.92per drink mix pack.
You save 20% ends today

Pink Rose Glam Lace Wedding Margarita Drink Mix

Qty:
Personalize this template

Other designs from this category

About Drink Mixes

Sold by

Style: Margarita Drink Mix

Cheers!!! Our personalized Margarita Favors are the perfect personalized addition to your celebration. The Margarita is the No. 1 selling cocktail in the world and evokes a sense of paradise, the laid-back lifestyle and a tropical retreat. Sounds like the perfect party favor for your guests!
Personalized packages of cocktail drink mix make a favor idea that’s in step with the latest trends. Celebrate with your very own signature cocktail! Our cocktail mixes will help make your celebration fun and memorable.

  • Proudly made in the USA
  • Single serving of premium drink mix
  • Comes sealed in a beautiful white gloss pouch
  • Instructions are on the back on how to mix the pouch contents with other ingredients to make the perfect cocktail
  • Great For Gifts and Favors
  • Easily self assembled with self-adhesive labels
  • Purchase pre-assembled for an upcharge
  • Dimensions: 4"w x 5.5"h
  • Non-Alcoholic

Nutrition Facts: Servings: 1, Serv. Size: 28 g, Amount per serving: Calories 110, Total Fat 0g (0%DV), Sat. Fat 0g (0% DV), Trans Fat 0g, Cholest. 10mg (0% DV), Sodium 0mg (0% DV). Total Carb. 27g (10% DV), Fiber 0g (0% DV), Total Sugars 26g, (Incl. O Added Sugars, 0% DV) Protein 0g, Calcium 60mg (4% DV), Not a significant source of Vit. A, Vit. D and Iron. Percent Daily Values (DV) are based on a 2,000 calorie diet.
INGREDIENTS: Pure Cane Sugar, Citric Acid, Natural and Artificial Flavor, Silicone Dioxide, Tricalcium Phosphate, Xanthan Gum, Arabic Gum, Color (Blue #1), Color (Yellow#5)

About This Design

The lace and rose gold elements are simulated in the artwork by the Creator. These elements will not be used in the making of this product.Browse real foil products
Pink Rose Glam Lace Wedding Margarita Drink Mix

Pink Rose Glam Lace Wedding Margarita Drink Mix

Pink Rose Glam Lace Wedding

Customer Reviews

4.8 out of 5 stars rating6 Total Reviews
5 total 5-star reviews1 total 4-star reviews0 total 3-star reviews0 total 2-star reviews0 total 1-star reviews
6 Reviews
Reviews for similar products
5 out of 5 stars rating
By Nancy B.April 11, 2023Verified Purchase
Custom Tea, Non-Assembled
Zazzle Reviewer Program
Absolutely adorable! Can’t wait to share them. Perfect for my daughters coffee/tea themed shower!!
5 out of 5 stars rating
By Nancy B.April 11, 2023Verified Purchase
Custom Tea, Non-Assembled
Zazzle Reviewer Program
So so cute! Cannot wait to show all my friends! So easy to assemble .
5 out of 5 stars rating
By C.December 4, 2023Verified Purchase
Custom Tea, Assembled
Zazzle Reviewer Program
Honestly haven't tried the tea yet. The quality of the bags and printing looks nice though. It was great to have something different and not something you see at all the other parties and events. The design turned out nice and colorful. Just what I wanted!

Tags

Drink Mixes
chicweddingpinkfemininegirlylacerose gold
All Products
chicweddingpinkfemininegirlylacerose gold

Other Info

Product ID: 256021615333605863
Created on: 3/29/2024, 12:26 PM
Rating: G