Tap / click on image to see more RealViewsTM
Sale Price $9.27.  
Original Price $10.30 Comp. value
per sticker
You save 10%

Playful friends drawing on sticker

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Large 8" x 8" Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 8" L x 8.5" W
  • Design Area: 8" L x 8" W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.125" border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Playful friends drawing on sticker

Playful friends drawing on sticker

Playful friends drawing design.

Customer Reviews

4.8 out of 5 stars rating11 Total Reviews
10 total 5-star reviews0 total 4-star reviews1 total 3-star reviews0 total 2-star reviews0 total 1-star reviews
11 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Marie S.June 1, 2021Verified Purchase
Medium 6" x 6" Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
Looks great! A variety of bright color designs for fun and whimsy. Gift for a book loving sister who gave me (the artist) lots of feedback on the design. These are Custom-Cut Vinyl Sticker and low tack ~ very cool! Very pleased. It comes with a choice of each sticker with a white outline. In hindsight the clear option would have been preferred but depends on it's placement too. Fun!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Alaenya H.January 13, 2022Verified Purchase
Extra-Small 3" x 3" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
My niece was born in AZ and she wanted a sticker for her water bottle from where she was born. She loved this design. The image quality was beautiful!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Angelo L.May 13, 2024Verified Purchase
Extra-Small 3" x 3" Sheet Custom-Cut Vinyl Stickers, Matte White
Really nice, solid. Like it a lot. Printing and colors are nice

Tags

Custom-Cut Vinyl Stickers
boygirlfriendsdrawingwhitepatternplayhappysmile
All Products
boygirlfriendsdrawingwhitepatternplayhappysmile

Other Info

Product ID: 256993414820906350
Created on: 6/1/2022, 11:28 AM
Rating: G