Tap / click on image to see more RealViewsTM
Sale Price $16.24.  
Original Price $19.10 Comp. value
per spool
You save 15%

Pretty Pink and Black Tweed Plaid Grosgrain Ribbon

Qty:
1.5"
Grosgrain

Other designs from this category

About Ribbon

Sold by

Material: Grosgrain Ribbon

Like icing on a cake, our ribbons are the toping that makes for the perfect present! Pick from two material types, two width options and personalize this accessory with text, images and designs. Wrap up your gift giving with our beautiful ribbon!

  • Material: Ribbed grosgrain with parallel ridges to enhance sturdiness
  • Choice of two widths - 1.5” or 3”
  • Sold in 2 yard, 6 yard and 10 yard spools
  • Full color custom printing on single side

About This Design

Pretty Pink and Black Tweed Plaid Grosgrain Ribbon

Pretty Pink and Black Tweed Plaid Grosgrain Ribbon

With a pretty black and pink tweed design this ribbon is elegant and classic. Perfect for gift wrapping and craft projects.

Customer Reviews

4.5 out of 5 stars rating474 Total Reviews
352 total 5-star reviews57 total 4-star reviews29 total 3-star reviews12 total 2-star reviews24 total 1-star reviews
474 Reviews
Reviews for similar products
5 out of 5 stars rating
By D.December 29, 2022Verified Purchase
3" Wide Satin Ribbon, 2 Yard Spool
Zazzle Reviewer Program
I was not sure what to expect, but this ribbon was beautifully made. The printing was sharp and clear. The fabric was luxurious. My client was extremely happy with the wreath that I made for her business. It was sharp and clear.
5 out of 5 stars rating
By Sharon F.May 5, 2016Verified Purchase
3" Wide Satin Ribbon, 6 Yard Spool
Creator Review
I could not be more pleased! This is part of my Sunflower Motif on my sharonrhea store here on Zazzle that grew because I loved each product that arrived. See the Collection. It started as a simple wedding binder and gift tote bag I designed for a wedding present, and unfortunately for my charge cards (yet thankfully on Zazzle, there are always GREAT DISCOUNTS and DEALS!), since I LOVED (as did everyone else) it so much, my mind always flitters off like a prodigious enormous HUMONGOUS diagram / plan thinking matching gift wrap would be nice and gift tags .... tissue ... a note card .... oh, and thank you cards to give the bride to use .... and so much more, and then, I did the same for presents for others. I love it! This ribbon is so pretty (I ordered it in all sizes), and I can tell you, everything Zazzle produced for me in this theme and others is better than I've seen anywhere on the market (and I am the queen of persnickety!)! I thank Zazzle for never disappointing me as I continue to say, the print and quality is POP OFF THE PAGE PERFECT! I'll add photos; yet, the true color is on the Zazzle Product Page since my flash made some photos a bit too yellow.
5 out of 5 stars rating
By Karla W.July 27, 2015Verified Purchase
1.5" Wide Satin Ribbon, 6 Yard Spool
Creator Review
This came bubble-wrapped like it was fine china! I'm impressed :) This is beautiful satin ribbon and very professionally done. Printing is beyond expectation - exactly as designed with a beautiful contrast between the muted background and the name.

Tags

Ribbon
pinkblacktweedplaidelegantfeminineclassicprettycutepattern
All Products
pinkblacktweedplaidelegantfeminineclassicprettycutepattern

Other Info

Product ID: 256581455414559941
Created on: 11/10/2022, 6:07 PM
Rating: G