Tap / click on image to see more RealViewsTM
Sale Price $40.80.  
Original Price $48.00. Comp. value
Sale Price $3.40per drink mix pack.
You save 15%

Pretty Pink Baby Girl Unicorn Custom Baby Shower Margarita Drink Mix

Qty:

Other designs from this category

About Drink Mixes

Sold by

Style: Margarita Drink Mix

Cheers!!! Our personalized Margarita Favors are the perfect personalized addition to your celebration. The Margarita is the No. 1 selling cocktail in the world and evokes a sense of paradise, the laid-back lifestyle and a tropical retreat. Sounds like the perfect party favor for your guests!
Personalized packages of cocktail drink mix make a favor idea that’s in step with the latest trends. Celebrate with your very own signature cocktail! Our cocktail mixes will help make your celebration fun and memorable.

  • Proudly made in the USA
  • Single serving of premium drink mix
  • Comes sealed in a beautiful white gloss pouch
  • Instructions are on the back on how to mix the pouch contents with other ingredients to make the perfect cocktail
  • Great For Gifts and Favors
  • Easily self assembled with self-adhesive labels
  • Purchase pre-assembled for an upcharge
  • Dimensions: 4"w x 5.5"h
  • Non-Alcoholic

Nutrition Facts: Servings: 1, Serv. Size: 28 g, Amount per serving: Calories 110, Total Fat 0g (0%DV), Sat. Fat 0g (0% DV), Trans Fat 0g, Cholest. 10mg (0% DV), Sodium 0mg (0% DV). Total Carb. 27g (10% DV), Fiber 0g (0% DV), Total Sugars 26g, (Incl. O Added Sugars, 0% DV) Protein 0g, Calcium 60mg (4% DV), Not a significant source of Vit. A, Vit. D and Iron. Percent Daily Values (DV) are based on a 2,000 calorie diet.
INGREDIENTS: Pure Cane Sugar, Citric Acid, Natural and Artificial Flavor, Silicone Dioxide, Tricalcium Phosphate, Xanthan Gum, Arabic Gum, Color (Blue #1), Color (Yellow#5)

About This Design

Pretty Pink Baby Girl Unicorn Custom Baby Shower Margarita Drink Mix

Pretty Pink Baby Girl Unicorn Custom Baby Shower Margarita Drink Mix

This awesome selection of Baby Shower drink mix sachets features a digital art image of a pretty magical pink baby girl unicorn. The main body of the unicorn is pink and the mane and tail are two different shades of pink. The unicorn has golden hooves and a bright shiny gold horn on top of its head. It has a pink diamond shaped eye. The unicorn has a big smile on its face. There is custom text so you can include your own message. These are Margarita sachets but you can also choose other drink mix sachets from the product page including Hot Chocolate, Lemonade, Coffee and Tea.

Customer Reviews

4.7 out of 5 stars rating12 Total Reviews
9 total 5-star reviews2 total 4-star reviews1 total 3-star reviews0 total 2-star reviews0 total 1-star reviews
12 Reviews
Reviews for similar products
5 out of 5 stars rating
By Nicole N.May 12, 2023Verified Purchase
Custom Tea, Non-Assembled
Zazzle Reviewer Program
These were perfect for our wellness retreat! The tea was also really good. .
5 out of 5 stars rating
By Melanie B.February 1, 2024Verified Purchase
Custom Tea, Assembled
Zazzle Reviewer Program
We bought this as part of a class gift for our tea loving teacher. I could not have been more pleased. Excellent, top quality item. I was so impressed with how perfect they arrived. No complaints, only praise here. They were more beautiful than I expected and they made the most perfect gift. The printing honestly exceeded my expectations. Clear, crisp and vibrant.
5 out of 5 stars rating
By Sandra P.August 5, 2022Verified Purchase
Custom Tea, Non-Assembled
Zazzle Reviewer Program
The tea bags are a perfect fit for the special tea cups ordered for a bridal shower. The template was easy to edit and the labels easy to apply to the tea bags. I love them so much I am placing a second order. Perfect! Exactly as it appeared on the template.

Tags

Drink Mixes
baby girlunicornpinkanimalsmagicalfantasygirlcutebaby showergender reveal
All Products
baby girlunicornpinkanimalsmagicalfantasygirlcutebaby showergender reveal

Other Info

Product ID: 256539396610594402
Created on: 3/3/2022, 4:44 AM
Rating: G 
Related Searches
drink mixesdrink mixes