Tap / click on image to see more RealViewsTM
Sale Price $21.08.  
Original Price $24.80 Comp. value
per wall decal
You save 15%

Pretty Pink Damask Large Princess Collection Wall Decal

Qty:
Multiple
Princess
Left

Other designs from this category

About Wall Decals

Sold by

Number of Shapes: Walls 360 Custom Wall Decal

Brighten up any room with a custom wall decal from Zazzle and Walls 360! Printed with premium eco-solvent inks on high-quality fabric paper, your images, text, and designs will pop off the wall with stunning clarity and color accuracy. Made to be moved, each wall decal can be peeled and repeeled up to one hundred times without damaging the decal or walls. No glue, no frames, no pain – make a space all your own with a customized wall decal!

  • Dimensions: 5 circles with the following diameters 3.22", 4.71" 2.18", 5.98", 4.94"
  • Brilliant high-resolution printing on self-adhesive fabric paper
  • Easy peel and restick up to 100 times. No wall damage or sticky residue
  • Manufactured by Walls 360 in Las Vegas, Nevada
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Pretty Pink Damask Large Princess Collection Wall Decal

Pretty Pink Damask Large Princess Collection Wall Decal

These darling items are further enhanced with pretty pink damask pattern, making them fit for any princess's decor.

Customer Reviews

4.8 out of 5 stars rating131 Total Reviews
116 total 5-star reviews13 total 4-star reviews0 total 3-star reviews0 total 2-star reviews2 total 1-star reviews
131 Reviews
Reviews for similar products
5 out of 5 stars rating
By Miriam Z.June 27, 2022Verified Purchase
18"x12" Cowboy Boot Wall Decal
Creator Review
Zazzle's wall decals are great for capturing a favorite design. Easy to apply as well as they can be reused up to one hundred times and without damage to the walls. Quality printing which is truly vivid.
5 out of 5 stars rating
By E.June 14, 2015Verified Purchase
18"x12" Cowboy Boot Wall Decal
Zazzle Reviewer Program
The product was just as I had hoped for. It is easy to apply and reapply on different surfaces with good hold. Bright color as seen on the website. The printing was easy to customize and came out as hoped for. Totally surprised to have it delivered so quickly and earlier than advertised.
4 out of 5 stars rating
By celeste h.December 18, 2013Verified Purchase
12"x12" High Heel Wall Decal
Zazzle Reviewer Program
I love the fact that I can stick these on the wall and move them from place to another and they stay in place. Very bright and exactly how I expected!

Tags

Wall Decals
princessgirlytiarapinkdamaskfloralflowersgirlcuteelegant
All Products
princessgirlytiarapinkdamaskfloralflowersgirlcuteelegant

Other Info

Product ID: 256757429118878881
Created on: 9/26/2012, 9:52 AM
Rating: G