Tap / click on image to see more RealViewsTM
Sale Price $8.21.  
Original Price $9.65 Comp. value
per sticker
You save 15%

Purple Pastel Butterfly Sticker

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Large 8" x 8" Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 8" L x 8.5" H
  • Design Area: 8" L x 8" H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.125" border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Purple Pastel Butterfly Sticker

Purple Pastel Butterfly Sticker

Here's a pretty addition to your suitcase, computer, tablet, and more! Choose your favorite sticker size. Save on top of the sale price with Zazzle Black's free shipping - which lasts an entire year! Visa, MasterCard, PayPal and American Express accepted. International shipping available for most items. You're invited to follow and/or bookmark our store front page so you won't miss any of our new items. Thank you for shopping, and have a great day!

Customer Reviews

4.7 out of 5 stars rating54 Total Reviews
48 total 5-star reviews2 total 4-star reviews1 total 3-star reviews1 total 2-star reviews2 total 1-star reviews
54 Reviews
Reviews for similar products
5 out of 5 stars rating
By Mindy B.November 12, 2019Verified Purchase
Medium 6" x 6" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I bought these decals for my daughter - she's personalized just about every water bottle she owns, so I thought it would be fun to add some acro love to the mix. They look great, and have held up in the dishwasher and through hand washing. The decal quality is great. The colors are rich and vibrant. There's a perfect border on each decal, too.
5 out of 5 stars rating
By Leslie L.May 31, 2019Verified Purchase
Zazzle Reviewer Program
These decals are so fun and versatile! The floral artwork is just beautiful and the decal itself seems to be very good quality. I have used these on cups that get wet, though not submerged in water, and they are holding up well after a couple of weeks of every day use. The printing is great! The design turned out just like the online image and is vibrant and colorful. Do be wary of the color of the surface you are placing these on when you get the transparent stickers. I was aware that there would be a bit of a color change, but they are a little more transparent than I expected. I still am very pleased with how it looks on my cup however and I wouldn’t hesitate to order them again.
Original product
5 out of 5 stars rating
By J.October 24, 2022Verified Purchase
Extra-Large 14" x 14" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
This is a great product. The design is beautiful, and it went on so easily to my laptop. I love it. I have had so many compliments. It is bright and really shows off the design. The printing was great. It looks just like the picture that I ordered from. Nice and bright.

Tags

Custom-Cut Vinyl Stickers
pastelgirlsteensstickersvinylwomenpurplebutterflysmall giftspastelerie
All Products
pastelgirlsteensstickersvinylwomenpurplebutterflysmall giftspastelerie

Other Info

Product ID: 256582122606634826
Created on: 1/2/2020, 6:25 AM
Rating: G