Tap / click on image to see more RealViewsTM
Sale Price $38.13.  
Original Price $44.85 Comp. value
per set of 50 napkins
You save 15%

Purple Pink Blue Butterfly Bridal Shower Napkins

Wedding Collection
Qty:
White

Other designs from this category

Shop this collection

Tap / click on image to see more RealViewsTM
 
 
 
 
 
 
 
 

About Paper Napkins

Sold by

Style: Standard Cocktail

A good celebration is as much about the presentation as it is about food. Serve up the party with custom personalized paper napkins that look good tucked in the collar or draped over your lap.

  • Dimensions: 4.75"l x 4.75"w (folded), 3 ply
  • Printed in full color on your choice of white or ecru colored napkins
  • Coined or standard napkin styles available
  • Sold in quantities of 50
  • Buy in bulk and save!
  • This product is food contact safe
Tip: When ordering napkins, the general rule is 3 napkins per guest.

About This Design

Purple Pink Blue Butterfly Bridal Shower Napkins

Purple Pink Blue Butterfly Bridal Shower Napkins

Personalize this exquisite Butterfly Bridal Shower Paper Napkin, a charming addition to your celebration. Embrace the whimsical beauty of fluttering pink, blue, and purple butterflies delicately adorned against a crisp white background. Each napkin is adorned with soft tones, featuring delicate white flowers intertwined with the elegant butterfly motif, creating a picturesque scene that exudes both femininity and grace. Featuring a boho floral design, these paper napkins effortlessly elevate any bridal shower decor, adding a touch of enchantment and sophistication to your event. Whether you're hosting a bridal shower party, picnic or a lavish affair, these pretty napkins are sure to impress your guests with their timeless elegance.

Customer Reviews

4.7 out of 5 stars rating1.3K Total Reviews
1131 total 5-star reviews91 total 4-star reviews36 total 3-star reviews24 total 2-star reviews55 total 1-star reviews
1,337 Reviews
Reviews for similar products
5 out of 5 stars rating
By Natalie D.September 22, 2021Verified Purchase
Paper Napkins, Standard Cocktail
Zazzle Reviewer Program
I bought these to use at my son’s wedding rehearsal dinner. They were a perfect addition to his golf themed groom’s cake! Color and font was perfect!
5 out of 5 stars rating
By Tyra F.February 4, 2022Verified Purchase
Paper Napkins, Standard Cocktail
Zazzle Reviewer Program
The plates and napkins were absolutely beautiful, great quality. Would recommend to everyone. Very Fast Delivery. Printing was Beautiful
5 out of 5 stars rating
By B G.September 16, 2021Verified Purchase
Paper Napkins, Standard Cocktail
Zazzle Reviewer Program
They turned out great! I ordered multiple items from Rustic Weddings and they all turned out great. The product came to me looking exactly the same as the preview which is not always the case. Perfect! Absolutely beautiful!

Tags

Paper Napkins
butterfly bridal showerpurplepinkblueboho floralflowersbridal showercalligraphywhimsicalfeminine
All Products
butterfly bridal showerpurplepinkblueboho floralflowersbridal showercalligraphywhimsicalfeminine

Other Info

Product ID: 256280182806499442
Created on: 9/10/2024, 3:06 AM
Rating: G