Tap / click on image to see more RealViewsTM
Sale Price $33.20.  
Original Price $39.05 Comp. value
per round throw pillow
You save 15%

Purple Shroom Round Pillow

Qty:

Other designs from this category

About Round Pillows

Sold by

Size: Round Throw Pillow (16")

Zazzle pillows now come in even more sizes and shapes! Make a statement without having to say a word when you accent your home with fully customizable pillows from Zazzle. Made from high-quality fabric, these soft pillows look great with your personalized designs, quotes monograms, and photos. The perfect complement to your living room, bedroom, and more!

  • Dimensions: 16" diameter (flat), 14" (stuffed)
  • Hidden zipper enclosure; synthetic-filled insert included
  • Made in the USA
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 16" x 16". For best results please add 3/4" bleed.

Fabric: Brushed Polyester

  • 100% brushed polyester is wrinkle free
  • Vibrant colors help designs really pop
  • Heavy cotton-blend-type texture makes fabric soft to the touch
  • High tensile strength fabric make for long lasting quality
  • Inserts are hypoallergenic and filled with a faux down polyester fiber
  • Machine washable, able to retain color and resist shrinkage

About This Design

Purple Shroom Round Pillow

Purple Shroom Round Pillow

Add a touch of whimsical charm to your space with this round pillow featuring a vibrant purple mushroom motif. The soft, plush fabric offers cozy comfort, while the detailed mushroom design brings a playful and mystical vibe to any room. Perfect for adding a pop of color to your couch, bed or favorite chair, this pillow is both stylish and functional, making it an ideal accent piece for nature and mushroom lovers.

Customer Reviews

4.7 out of 5 stars rating201 Total Reviews
160 total 5-star reviews26 total 4-star reviews7 total 3-star reviews3 total 2-star reviews5 total 1-star reviews
201 Reviews
Reviews for similar products
5 out of 5 stars rating
By Erika D.April 20, 2020Verified Purchase
Brushed Polyester Round Throw Pillow (16")
Creator Review
This is a good size, good color, great shape. From far away it looks like the symbol for OM but upon closer inspection you can read a bunch of sanskrit names for yoga poses like sun salutations and mountain pose and child's pose.... It's missing a few of my favorites but has several others I have still to work on. But it definitely works well as a comfortable cushion for my meditation practice. I ordered it to supplement my recent yoga studies. Both sides feature a fairly intricate printing - from far away it looks like the symbol for OM but upon closer inspection you can read a bunch of sanskrit names for yoga poses like sun salutations and mountain pose and child's pose.... And the words are very clear. On both sides.
5 out of 5 stars rating
By Suzy M.March 10, 2018Verified Purchase
Brushed Polyester Round Throw Pillow (16")
Creator Review
I changed the background colour to match my sofa bed. When the pillow is plumped out and round, I have had people not want to sit down in case they disturb the sleeping cat. Great quality fabric, easy to throw in washing machine when needed and it came out the same after a gentle cold wash. So detailed and realistic.
5 out of 5 stars rating
By Billie M.December 21, 2021Verified Purchase
Grade A Cotton Round Throw Pillow (16")
Creator Review
Comfortable and durable fabric. Nice size for living room, lounge or bedroom areas. Artwork printed perfectly.

Tags

Round Pillows
mushroommagicwhimsicalhippyfantasynaturevibrantcozy
All Products
mushroommagicwhimsicalhippyfantasynaturevibrantcozy

Other Info

Product ID: 256060832306113880
Created on: 8/28/2024, 10:16 AM
Rating: G