Tap / click on image to see more RealViewsTM
The foil and rose gold elements are simulated in the artwork by the Creator. These elements will not be used in the making of this product.Browse real foil products
Sale Price $1.90.  
Original Price $2.71 Comp. value
per card
You save 30% ends today

Retirement Party Elegant Pink Rose Gold Feminine Invitation

Qty:
Choose Your Format

Envelopes

Choose from blank envelopes or save time with addressable envelopes

Squared
+$0.20
+$0.25
+$0.25
+$0.25
+$0.25
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$1.44
+$0.59
+$0.59
+$0.59
-$0.16

Other designs from this category

About Invitations

Sold by

Size: 5" x 7"

Make custom invitations and announcements for every special occasion! Choose from six curated paper types, two printing options, and six shape options to design a card that's perfect for you.

  • Dimensions: 5" x 7" (portrait or landscape)
  • Envelopes included but can be removed if not needed
  • High quality, full-color, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Two printing options available: Standard and High-Definition
  • 6 curated paper types to choose from
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 5" x 7". For best results please add 1/16" bleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

The foil and rose gold elements are simulated in the artwork by the Creator. These elements will not be used in the making of this product.Browse real foil products
Retirement Party Elegant Pink Rose Gold Feminine   Invitation

Retirement Party Elegant Pink Rose Gold Feminine Invitation

This elegant pink and rose gold retirement party invitation with a vintage air, recommended for a woman, has an ornate (faux) rose gold foil frame with elegant baroque decorations on a blush pink background. The name is written in an elegant calligraphy. All text can be personalized and has a pink color similar to the rose gold frame. The vintage, ornate frame is based on an antique French book cover binding, by Georges Mercier (1885-1939) - Madame de Maupin by Teophile Gautier, edition 1911, now in the public domain.

Customer Reviews

4.8 out of 5 stars rating70K Total Reviews
61818 total 5-star reviews5691 total 4-star reviews1079 total 3-star reviews513 total 2-star reviews849 total 1-star reviews
69,950 Reviews
Reviews for similar products
5 out of 5 stars rating
By Margaret O.September 22, 2021Verified Purchase
Flat Invitation, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Zazzle Reviewer Program
After cruising the Internet for weeks for an invitation to an 85th birthday party for a life-long car enthusiast, we landed at Zazzle. All our guests raved about the invitation: a racy exotic car that said it all and helped set the theme for the event. Who ever knows what to expect when ordering online from a new company? The high caliber of the card stock and print job were a great relief. Moreover, the order was executed quickly and efficiently. We were so pleased that we used Zazzle soon after for another print job.
5 out of 5 stars rating
By AnonymousFebruary 10, 2022Verified Purchase
Flat Invitation, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Zazzle Reviewer Program
We ordered this invitation first as just a sample because I loved the color combination. We ordered many other samples invitations (thanks to Zazzle Black). But ultimately ended up coming back to this (our first) because is simply was exactly what I was looking for. I actually ended up using the color pallet for our entire wedding! We had an outdoor ceremony and inside reception and these invitations were the perfect introduction for our guests to the type of event we were planning. Not too fancy but also not a casual evening wedding. The colors were vibrant and the paper was just the right amount of weight. We ordered the matching RSVP cards, the mauve envelopes with return address printed on the back, the belly bands to tie it all together, and the menus. Postage to send all this out was only .78 each. We highly recommend these invites and this seller was very responsive, our orders went out very timely. Thank you so much! We were so happy with all your paper products! I was extremely satisfied with the colors of our invitations. I couldn't have been happier with the print!
5 out of 5 stars rating
By Kathryn L.October 18, 2020Verified Purchase
Flat Invitation, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Zazzle Reviewer Program
The product exceeded my expectations and was of high quality. the paper was thick and was a perfect invitation for my wedding. the colors were just as expected and vibrant. I have no worries that those receiving the invitations will know how much work was put into the product.

Tags

Invitations
retirement partyelegantblush pinkrose goldfemininevintagecalligraphyscriptornateantique
All Products
retirement partyelegantblush pinkrose goldfemininevintagecalligraphyscriptornateantique

Other Info

Product ID: 256290993018250813
Created on: 8/10/2025, 12:56 PM
Rating: G