Tap / click on image to see more RealViewsTM
Sale Price $44.96.  
Original Price $49.95 Comp. value
each
You save 10%

Retro Blush Brun Sunset Scarf

Qty:
Medium Square (36" x 36")
-$20.00
-$5.00
-$10.00
Light Grey

Other designs from this category

About Chiffon Scarves

Sold by

Size: Medium Square Kerchief Chiffon Scarf, 36" x 36"

"I feel pretty, oh so pretty!" Elevate your style with a custom printed scarf in a delicate and lovely chiffon fabric. Beautifully finished with a professional baby hem, this scarf is the perfect accent piece that you can wear into the fall and beyond.

  • Dimensions: 36" x 36"
  • Material: Lightweight chiffon fabric
  • Clean rolled hem; scarves will be printed, hand-cut, and sewn by skilled seamstresses using top-of-the-line finishing machines
  • Print is visible on both sides
  • Hem available in 4 different finishing thread colors
  • Hand wash cold, lay flat to dry
  • Print may fade 5-10% after first wash, but sublimation printing allows for colors that are designed to last
If your scarf feels stiff, mist with water and tumble in a low heat dryer for 5-10 mins

About This Design

Retro Blush Brun Sunset  Scarf

Retro Blush Brun Sunset Scarf

Gift a thoughtful and practical gift, great for all occasions. Protect you head, hair and neck from wind rain and sun with our beautiful and patterned sophisticated wearing our Retro Blush Brun Sunset motif scarf.

Customer Reviews

4.9 out of 5 stars rating99 Total Reviews
93 total 5-star reviews4 total 4-star reviews0 total 3-star reviews0 total 2-star reviews2 total 1-star reviews
99 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Mary M.March 16, 2024Verified Purchase
Long (10" x 45"), White
I created this scarf using one of my abstract paintings as the design. I am delighted with the results! The colors reproduced beautifully and the chiffon fabric is soft and silky. I have one for myself and gave another one as a gift. The recipient LOVES it! Colors printed beautifully.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Geoff D.September 26, 2021Verified Purchase
Long (10" x 45"), Black
Zazzle Reviewer Program
Can’t wait to give this as a gift at Christmas. The design work is absolutely stunning! And the quality of the scarf itself is very nice. Just as pictured….love the way the print transferred to this chiffon fabric.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Margo O.May 13, 2024Verified Purchase
Medium Square (36" x 36"), Black
Creator Review
The lovely bright colors are lbeautiful on this chiffon scarf. I pu.rchased the tote bag with the same dwsign. The print came out very great!

Tags

Chiffon Scarves
accessoriesstylewrapsscarvesscarfretrofashionholidaysbirthdaysoccasion
All Products
accessoriesstylewrapsscarvesscarfretrofashionholidaysbirthdaysoccasion

Other Info

Product ID: 256801217678813280
Created on: 4/14/2025, 7:54 AM
Rating: G