Tap / click on image to see more RealViewsTM
Sale Price $18.12.  
Original Price $24.15 Comp. value
per mug
You save 25% ends today

Royal Asatru: Norse Battle Beer Stein

Qty:
Stein
-$7.30
-$6.40
-$5.45
-$2.75
-$1.80
+$1.85
Gray/Blue

Other designs from this category

About Mugs

Sold by

Style: Stein

Don't just drink beer, celebrate it with a made-to-order Zazzle beer stein. Our traditional German beer mug features ornate borders at the rim and base and a detailed handle. Honor your beer with the right vessel for the job, or give a stein to the beer lover in your life.

  • Available in 2 colors – white with metallic gold and gray with blue color
  • Dimensions:
    • Grey/Blue 22-ounce: 3" D x 6.6" H
    • White/Gold 20-ounce: 3" D x 6.6" H
  • Hand wash
  • Meets FDA requirements for food and beverage safety
  • Printed on demand in Reno, NV
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Royal Asatru: Norse Battle Beer Stein

Royal Asatru: Norse Battle Beer Stein

This noble design features a classic illustration of a battle scene in a Dutch china motif.

Customer Reviews

4.8 out of 5 stars rating671 Total Reviews
564 total 5-star reviews76 total 4-star reviews17 total 3-star reviews6 total 2-star reviews8 total 1-star reviews
671 Reviews
Reviews for similar products
5 out of 5 stars rating
By SHARLA C.November 16, 2021Verified Purchase
Stein, Blue/Grey 22 oz / White/Gold 20 oz
Zazzle Reviewer Program
This stein was out of stock for the longest time. I kept checking to see if it was back and low and behold - Eureka! It was back in stock. I am so glad I waited and didn't attempt to try to find something else. The pricing is extremely good as well for a custom, personalized gift! And since I had already uploaded the design, all I had to do was add it to my cart and purchase it. It looks amazing! Better than expected, great quality and just beautiful! I love it and can't wait to give it to my boss for Christmas! Thank you so much, Zazzle. The designer did a great job! The printing is perfect and the colors are on point. Plus, the mug itself is a great quality piece. Beautiful! I love it!
5 out of 5 stars rating
By Kimball M.June 26, 2019Verified Purchase
Stein, Blue/Grey 22 oz / White/Gold 20 oz
Creator Review
My friends enjoyed this present I made for them. Great printing as always!
5 out of 5 stars rating
By Evan W.August 27, 2025Verified Purchase
Stein, Blue/Grey 22 oz / White/Gold 20 oz
These worked out great for our event! .

Tags

Mugs
asatruheathenvikingheathenrypagangiftsnorsebattleartifacthistoric
All Products
asatruheathenvikingheathenrypagangiftsnorsebattleartifacthistoric

Other Info

Product ID: 168644807982400119
Created on: 1/20/2013, 5:14 AM
Rating: G 
Related Searches
beer glassesbeer glasses