Tap / click on image to see more RealViewsTM
The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.Browse real foil products
Sale Price $4.68.  
Original Price $5.50 Comp. value
per invitation
You save 15%

Rustic Barn Wood Lace Wedding Photo Tri-Fold Invitation

Qty:
Personalize this template
Vertical

Envelopes

Choose from blank envelopes or save time with addressable envelopes

Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$0.55
+$0.55
-$0.15

Other designs from this category

About Trifold Letter Fold Invitations

Sold by

Size: 5" x 7"

An invitation for every occasion! The tri-fold letter fold design has more space to include all your important details.

  • Dimensions: 5" x 7" tri- fold
  • Full CMYK print process
  • Printing on all sides for no additional cost
  • Standard white envelopes included

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.Browse real foil products
Rustic Barn Wood Lace Wedding Photo Tri-Fold Invitation

Rustic Barn Wood Lace Wedding Photo Tri-Fold Invitation

Amaze your guests with this elegant all in one wedding invite featuring beautiful lace on a rustic wood background with detachable RSVP card. Simply add your event details on this easy-to-use template and adorn this card with your favorite photo to make it a one-of-a-kind invitation.

Customer Reviews

4.7 out of 5 stars rating287 Total Reviews
238 total 5-star reviews28 total 4-star reviews6 total 3-star reviews6 total 2-star reviews9 total 1-star reviews
287 Reviews
3 out of 5 stars rating
By E.January 3, 2022Verified Purchase
Trifold Letter Fold Invitation, Size: 5" x 7", Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
The paper on this was top quality. The design however left something missing even though I wanted to love it. Image quality was fairly dull in person compared to online.
Reviews for similar products
5 out of 5 stars rating
By Nichole R.May 18, 2024Verified Purchase
Trifold Letter Fold Invitation, Size: 5" x 7", Paper: Signature Matte, Envelopes: White
The invitations came out absolutely beautiful. We have received a lot of compliments on them. We were very happy with how they turned out. Overall they were good. There were a few that we cut improperly so I am glad we ordered some extra ones.
5 out of 5 stars rating
By JoAnn T.June 30, 2022Verified Purchase
Trifold Letter Fold Invitation, Size: 5" x 7", Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
I loved working with Zazzle start to finish. I was able to edit the invitation with the colors and even change some of the layout to create the exact invitation we wanted. We had pictures, added our story, and even used the back for a fun sequence going in for a kiss. When we submitted the purchase they looked over the document, had us correct some things due to a licensing issue, and when all was cleared the process began. Then we had an issue come up that needed us to change the date. Luckily the printing hadn't happened yet so we were able to cancel the order and reissue the card. When we got it we were very impressed! High quality paper and finish, and everything looked great. We would definitely recommend this company and this product! The finished product was amazing! Very high quality!

Tags

Trifold Letter Fold Invitations
barn wedding3 in 1all in oneoutdoorbackyardfarmelegantchicvintagecountry
All Products
barn wedding3 in 1all in oneoutdoorbackyardfarmelegantchicvintagecountry

Other Info

Product ID: 256011811762018066
Created on: 1/18/2021, 8:53 PM
Rating: G