Sell on Zazzle
Tap / click on image to see more RealViewsTM
Sale Price $7.27.  
Original Price $8.55 Comp. value
per sticker
You save 15%

Saigon Ho Chi Minh City HCMC Vietnam Sunset Sticker

4.7 out of 5 stars rating
23 Total Reviews |
by
Qty:
Personalize this template
Sticker Sheet Size
Media

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by
Custom-Cut Vinyl Sticker
Create your own from scratch

Sticker Sheet Size: Medium 6" x 6" Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 6" L x 6.5" H
  • Design Area: 6" L x 6" H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.125" border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Saigon Ho Chi Minh City HCMC Vietnam Sunset Sticker

Saigon Ho Chi Minh City HCMC Vietnam Sunset Sticker

Saigon or Ho Chi Minh City skyline in Vietnam with sunset cityscape souvenir for Southeast Asia vacation. Saigon Ho Chi Minh City with Skyline in Vietnam as a souvenir for Asia and HCMC. Saigon Sunset Ho Chi Minh City Panorama Lifestyle for Urban Backpackers and Vietnamese City Trip. Saigon Panorama Ho Chi Minh City in Southeast Asia and Vietnam sunset cityscape design souvenir. Saigon Ho Chi Minh City city design for travel to HCMC and Asia or South Vietnam. Saigon Ho Chi Minh City with skyline for Vietnam vacation. You can easily customize and personalize the design by enter the name you want.
Photography Gift
Bronze
Artwork designed by
Germany
View their Store

Customer Reviews

4.7 out of 5 stars rating23 Total Reviews
20 total 5-star reviews2 total 4-star reviews0 total 3-star reviews0 total 2-star reviews1 total 1-star reviews
23 Reviews
Reviews for similar products
5 out of 5 stars rating
By Chandler A.August 23, 2023 • Verified Purchase
Small 4" x 4" Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
The decal is perfect...it arrived ahead of schedule, was well priced and functions as a nice give away for our customers. It adheres well too. Chandler. Great job...the printing is very clear...
5 out of 5 stars rating
By SAIR A.January 9, 2025 • Verified Purchase
Large 8" x 8" Sheet Custom-Cut Vinyl Stickers, Matte White
My first time trying Zazzle and Zazzle is amazing. The stickers are awesome and this is very good for business.
5 out of 5 stars rating
By Dale B.March 14, 2025 • Verified Purchase
Extra-Large 14" x 14" Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Thing are great to label all the cases and property of my ministry/business equipment. It is very stylish and looks very good.

Tags

Custom-Cut Vinyl Stickers
saigonho chi minh cityskylinevietnamcityscapehcmcsunsetpanoramaretrocity
All Products
saigonho chi minh cityskylinevietnamcityscapehcmcsunsetpanoramaretrocity

Other Info

Product ID: 256998807896294676
Created on: 6/17/2023, 5:33 AM
Rating: G 
Related Searches
business bumper stickersbusiness bumper stickers