Tap / click on image to see more RealViewsTM
Sale Price $65.11.  
Original Price $76.60 Comp. value
per board
You save 15%

Sea Turtles Peace Prayer Poem Dry Erase Board

Qty:
Large w/ Pen 22" L x 16" W
Foam Adhesive

Other designs from this category

About Dry Erase Boards

Sold by

Style: Large w/ Pen 22" L x 16" W

Add this to your to-do list: Order a customized dry-erase board from Zazzle today! Vibrantly printed using the AcryliPrint HD process, you can personalize this dry-erase board with photos, artwork, or text. Choose from 4 different kinds of backing options for easy mounting on any surface and set reminders no one will miss!

  • Dimensions: 22"l x 16"w; Thickness: 0.125"
  • Available in seven additional styles
  • Printed with high definition AcryliPrint process
  • Includes black dry erase pen
  • Choice of four backing types - 3M command strips, Adhesive, Magnetic or None
  • Option to preattach pen holder to board

Adhesive Backing: Foam Adhesive

For mounting on any hard surface. Recommended for permanent mounting

About This Design

Sea Turtles Peace Prayer Poem Dry Erase Board

Sea Turtles Peace Prayer Poem Dry Erase Board

Wonderful collage of vintage fine art Watercolor paintings of Sea Turtles swimming with part of a Poem/Prayer about the peace and calm of God in a storm by John Greenleaf Whittier is on this Dry Erase Board. Images are public domain due to no copyright and general permission by the artist to use. Collage is by me.

Customer Reviews

4.7 out of 5 stars rating308 Total Reviews
251 total 5-star reviews45 total 4-star reviews7 total 3-star reviews1 total 2-star reviews4 total 1-star reviews
308 Reviews
Reviews for similar products
5 out of 5 stars rating
By R K.April 8, 2024Verified Purchase
This is so much nicer/cleaner looking than the dry erase board tracker I had made myself and had been using for years! Only issue is the pen holder placement. It's not in an ideal spot for my needs, but it's not the end of the world! Still works so much better than what we had before and looks great! Printing turned out perfectly
5 out of 5 stars rating
By Frankie L.February 21, 2023Verified Purchase
Large w/ Pen 22" L x 16" W Dry Erase Board, Foam Adhesive, Pen holder attached
Zazzle Reviewer Program
This is perfect! High quality and exactly what I was looking for. Thank you Merkari Designs! perfect, 10/10 and I’m so excited to use it every month
5 out of 5 stars rating
By J.March 29, 2015Verified Purchase
Zazzle Reviewer Program
Great size, high quality. Love it! Printing was greats. Love the customization aspect! Great company!

Tags

Dry Erase Boards
dry erase boardpoempeaceprayerwildlifeanimalssea turtlesoceanseajesus
All Products
dry erase boardpoempeaceprayerwildlifeanimalssea turtlesoceanseajesus

Other Info

Product ID: 256099473823236729
Created on: 9/11/2017, 1:25 AM
Rating: G