Tap / click on image to see more RealViewsTM
The glitter details are simulated in the artwork. No actual glitter will be used in the making of this product.
Sale Price $14.88.  
Original Price $17.50 Comp. value
per window cling
You save 15%

Silver Spider Halloween Window Cling

Collection
Qty:
12" x 12"
Automatic Opaque Design: White Underbase
Rectangle

Other designs from this category

Shop this collection

Lisa Sorrell
Silver HalloweenDesigned by Lisa Sorrell
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

About Window Clings

Sold by

Shape: Rectangle

Turn your glass surfaces into decorations, promotions, signage and more with custom window clings. These versatile and reusable vinyl clings stick to glass surfaces through static electricity so leave no sticky residue behind. From displaying new promotions on your business’s window and using that empty window space to boost your brand, to decorating a window in your home, you’ll find so many great uses for these clings.

  • Dynamically Sized - ranging from 4” x 4” to a max of 52” x 72” (or max 72” x 52” if horizontal/landscape is selected)
  • Material - 7.5 mil static cling vinyl
  • Non Adhesive: Sticks to glass surfaces electro-statically
  • Choose from rectangle or custom cut shapes

Application Instructions:

  • Clean the surface you wish to apply the window cling to with hot water and dishwasher soap and wait until dry
  • Next, apply a light mist of water to your surface. Peel the decal from backing paper and place it on your surface, slide it around until you’re happy with its placement
  • Once it’s positioned perfectly, use a squeegee or flat plastic card to remove any air bubbles and wipe your window dry
  • To reposition or remove, simply peel away. It’s non-adhesive so there’ll be no residue left on the surface

Print Process: Automatic Opaque Design: White Underbase

Art is printed on a transparent sheet of plastic, but white ink is printed beneath all art, making those areas opaqaue while also making colors vivid

Adhesive: Cling art faces inward

Adhesive side is on the back of the window cling. All text and art is printed on the front of the window cling and faces towards the person applying it to the window. The art and text printed on the window cling will appear correctly when viewed from the same side of the window that it has been applied.

About This Design

The glitter details are simulated in the artwork. No actual glitter will be used in the making of this product.
Silver Spider Halloween Window Cling

Silver Spider Halloween Window Cling

This elegant but spooky design will add a dark and mysterious touch to your Halloween décor.

Customer Reviews

1.8 out of 5 stars rating5 Total Reviews
1 total 5-star reviews0 total 4-star reviews0 total 3-star reviews0 total 2-star reviews4 total 1-star reviews
5 Reviews
Reviews for similar products
1 out of 5 stars rating
By Stacie A.October 31, 2024Verified Purchase
Window Cling, Size: 11.00" x 8.00", Style: Partial Transparent Design: No Underbase, Shape: Rectangle, Display: Back of Cling
Arrived late, also it was a very bad cut out and it was so bad that it was unusable. I tried to save it and use it as a whole piece but it was impossible. Definitely don’t go with this seller, especially if you need it by a certain time. .
5 out of 5 stars rating
By Taylor O.January 4, 2023Verified Purchase
Window Cling, Size: 11.00" x 8.00", Style: Partial Transparent Design: No Underbase, Shape: Rectangle, Display: Back of Cling
Zazzle Reviewer Program
Came out perfectly! Loved the way it looks and will be perfect for our wedding welcome sign. Very clean and crisp
1 out of 5 stars rating
By K.April 26, 2024Verified Purchase
No instructions on how to apply this product to the glass/mirror. When I tried to apply, it is slightly blurry, which defeats my purpose of having this as a welcome sign mirror for selfies and pictures at my wedding. I took it off and will find a new product. Sizing didn't seem right to me.
Original product

Tags

Window Clings
gothic vintagehappy halloweenelegantcreepyminimalistdarkspookyspidersilver glitterantique
All Products
gothic vintagehappy halloweenelegantcreepyminimalistdarkspookyspidersilver glitterantique

Other Info

Product ID: 256151905790813882
Created on: 8/8/2024, 3:20 AM
Rating: G