Tap / click on image to see more RealViewsTM
Sale Price $2.16.  
Original Price $3.08 Comp. value
per card
You save 30%

Simple Black and White Script Save The Date

Qty:
Choose Your Format

Envelopes

Choose from blank envelopes or save time with addressable envelopes

Squared
+$0.20
+$0.25
+$0.25
+$0.25
+$0.25
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$1.62
+$0.67
+$0.67
+$0.67
-$0.18

Other designs from this category

About Flat Save The Date Cards

Sold by

Size: 5" x 7"

Hip hip hooray, it's time to spread the good cheer; a date so important you have to save it!

  • Dimensions: 5" L x 7" H (portrait); 7" L x 5" H (landscape)
  • High-quality, full-color, full-bleed printing on both sides
  • Add personal photos and text for no additional upcharge
  • Envelopes included but can be removed if not needed

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Simple Black and White Script Save The Date

Simple Black and White Script Save The Date

This simple black and white save the date card features a pretty script save the date with a leaf motif, set above your details in an elegant modern text.

Customer Reviews

4.8 out of 5 stars rating2.5K Total Reviews
2162 total 5-star reviews209 total 4-star reviews48 total 3-star reviews22 total 2-star reviews30 total 1-star reviews
2,471 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kristine B.October 14, 2022Verified Purchase
Flat Save The Date Card, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Zazzle Reviewer Program
My save the dates arrived and I could not open them fast enough. They were perfect. Got them all sent out and the response from our future guest was just wow. We were getting phone calls and text messages from so many people. Both men and woman. People just loved them. They were better than I expected. High quality. Just love them. I cannot wait to customize the invitations.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Dominika K.February 13, 2026Verified Purchase
Flat Save The Date Card, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Exactly what I was hoping for, very easy to create & shipped quickly! I got the semi gloss & they definitely feel higher quality without breaking the budget. .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Emily M.January 23, 2026Verified Purchase
Flat Save The Date Card, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
I’m a huge fan of Zazzle’s customer service. I originally ordered my save the dates on matte paper since that was advertised as their best selling paper. I didn’t think too much of it. When I received them, the full front photo just appeared dull and I was not happy with the final product. I was able to get a full refund, and re-ordered them on glossy paper and I am so much happier with the product! If you are printing photos, I highly recommend the glossy paper for a crisper print job. .

Tags

Flat Save The Date Cards
save the date weddinganniversary save the dateengagement save the datescriptblack and whitesimplechicelegantstylishleaf motif
All Products
save the date weddinganniversary save the dateengagement save the datescriptblack and whitesimplechicelegantstylishleaf motif

Other Info

Product ID: 256766060584492636
Created on: 12/5/2019, 8:50 AM
Rating: G