Tap / click on image to see more RealViewsTM
Sale Price $1.85.  
Original Price $3.08 Comp. value
per card
You save 40%

Simple Black and White Script Save The Date

Qty:
Choose Your Format

Envelopes

Choose from blank envelopes or save time with addressable envelopes

Squared
+$0.20
+$0.25
+$0.25
+$0.25
+$0.25
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-$0.18
+$0.67
+$0.67
+$1.62
+$0.67

Other designs from this category

About Flat Save The Date Cards

Sold by

Size: 5" x 7"

Hip hip hooray, it's time to spread the good cheer; a date so important you have to save it!

  • Dimensions: 5" L x 7" H (portrait); 7" L x 5" H (landscape)
  • High-quality, full-color, full-bleed printing on both sides
  • Add personal photos and text for no additional upcharge

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Simple Black and White Script Save The Date

Simple Black and White Script Save The Date

This simple black and white save the date card features a pretty script save the date with a leaf motif, set above your details in an elegant modern text.

Customer Reviews

4.8 out of 5 stars rating2.3K Total Reviews
2031 total 5-star reviews200 total 4-star reviews33 total 3-star reviews15 total 2-star reviews21 total 1-star reviews
2,300 Reviews
Reviews for similar products
5 out of 5 stars rating
By Kristine B.October 14, 2022Verified Purchase
Flat Save The Date Card, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Zazzle Reviewer Program
My save the dates arrived and I could not open them fast enough. They were perfect. Got them all sent out and the response from our future guest was just wow. We were getting phone calls and text messages from so many people. Both men and woman. People just loved them. They were better than I expected. High quality. Just love them. I cannot wait to customize the invitations.
5 out of 5 stars rating
By A.February 4, 2022Verified Purchase
Flat Save The Date Card, Size: 3.5" x 5", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Zazzle Reviewer Program
It shipped earlier than I thought thank you! I love how they came out, looks so much better in person! The colors came out perfect. I did not get HD but it still came out beautiful! Pictures of the roses came out nice and colors looked exactly like the order, thank you!
5 out of 5 stars rating
By Sheila J.July 4, 2023Verified Purchase
Flat Save The Date Card, Size: 5" x 7", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Creator Review
The matter paper is our sample of choice -- it's a reasonably priced, good quality, nice feeling paper stock. We were a little concerned the muted rustic blues might not reproduce all that well (usually by light colored samples), but they're just gorgeous! The white lettering is perfect in combination with the blue background, and the typography is all easy to read.

Tags

Flat Save The Date Cards
save the date weddinganniversary save the dateengagement save the datescriptblack and whitesimplechicelegantstylishleaf motif
All Products
save the date weddinganniversary save the dateengagement save the datescriptblack and whitesimplechicelegantstylishleaf motif

Other Info

Product ID: 256766060584492636
Created on: 12/5/2019, 8:50 AM
Rating: G