Tap / click on image to see more RealViewsTM
The glitter and foil elements are simulated in the artwork by the Creator. These elements will not be used in the making of this product.Browse real foil products
Sale Price $58.00.  
Original Price $68.00. Comp. value
Sale Price $0.58per candy.
You save 15%

Style: Hershey®'s Kisses® These mouthwatering litt

Qty:
Pink

Other designs from this category

Shop this collection

 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

About Hershey's Candy Favorss

Sold by

Style: Hershey®'s Kisses®

These mouthwatering little drops of goodness have been putting a smile on people's faces since 1907, over one hundred years of sugary sweetness! Sprinkle Hershey®'s Kisses® on tables to add sparkle to your occasion or arrange Kisses® in unique vases or bowls and use as centerpieces. However you choose to spread these little favors make sure you have enough… after all one kiss is NEVER enough!

  • Proudly made in the USA
  • Great For Gifts and Favors
  • The Sweetest Favors for your Special Day
  • Easily self assembled with self-adhesive labels
  • Purchase pre-assembled for an upcharge
  • Gold foil Hershey's Kisses contain almonds
  • Dimensions: 0.875" dia. x 1"h
  • Suggested quantity per guest: 5-10 kisses
  • Choose from a variety of foil colors
  • Kosher ⓊD
  • Store at room temperature
  • Allergy Information: Gold foil Hershey's Kisses contain almonds. For complete information regarding any Hershey's products, please contact The Hershey Company

Nutrition Facts
about 50 servings per container
Serving size 7 pieces (32g)
Amount per serving
Calories 160
Total Fat
9g, 12% (% Daily Value*)
Saturated Fat 6g, 29%
Trans Fat 0g
Cholesterol 10mg, 3%
Sodium 25mg, 1%
Total Carbohydrate 19g, 7%
Dietary Fiber <1g, 3%
Total Sugars 18g
Includes 16g Added Sugars, 31%
Protein 2g

Vitamin D 0.5mcg, 2%
Calclum 60mg, 4%
Iron 1.2mg, 6%
Potassium 120mg, 2%

The % Daily Value tells you how much a nutrient in a serving of food contributes to a daily diet. 2,000 calories a day is used for general nutrional advice.

INGREDIENTS: MILK CHOCOLATE| SUGAR; MILK CHOCOLATE; COCOA BUTTER, MILK FAT; LECITHIN (SOY): NATURAL FLAVOR)

GLUTEN FREE

About This Design

The glitter and foil elements are simulated in the artwork by the Creator. These elements will not be used in the making of this product.Browse real foil products
Style: Hershey®'s Kisses® These mouthwatering litt

Style: Hershey®'s Kisses® These mouthwatering litt

Style: Hershey®'s Kisses® These mouthwatering little drops of goodness have been putting a smile on people’s faces since 1907, over one hundred years of sugary sweetness! Sprinkle Hershey®'s Kisses® on tables to add sparkle to your occasion or arrange Kisses® in unique vases or bowls and use as centerpieces. However you choose to spread these little favors make sure you have enough… after all one kiss is NEVER enough! Proudly made in the USA Great For Gifts and Favors The Sweetest Favors for your Special Day Easily self assembled with self-adhesive labels Purchase pre-assembled for an upcharge Gold foil Hershey's Kisses contain almonds Dark Purple foil Hershey's Kisses contain dark chocolate Dimensions: 0.875" dia. x 1"h Suggested quantity per guest: 5-10 kisses Choose from a variety of foil colors Kosher ⓊD Store at room temperature Allergy Information: Gold foil Hershey's Kisses contain almonds. For complete information regarding any Hershey's products, please contact The Hershey Company

Customer Reviews

3.8 out of 5 stars rating52 Total Reviews
29 total 5-star reviews7 total 4-star reviews2 total 3-star reviews4 total 2-star reviews10 total 1-star reviews
52 Reviews
Reviews for similar products
5 out of 5 stars rating
By Elizaverg G.April 29, 2024Verified Purchase
came out super cute for a favor for my wedding! clear and vibrant colors
1 out of 5 stars rating
By Kelsee C.June 20, 2024Verified Purchase
Hershey®'s Kisses® Candy Favors, Non-Assembled
I ordered these for my blueberry themed baby shower which is only 9 days away. They seemed to be packaged well but after I pulled the bag out of the package I’m finding holes in the wrappers. Without opening the bag they were shipped in I took pictures, it was very obvious that more than half of the candy has a ripped wrapper or is already opened on the top. I can not serve my guests half opened candy, do not waste your money on this product. The labels however are beautiful and I’m now wishing I purchased only labels for the kisses and bought my own candy at walmart. .
5 out of 5 stars rating
By Dana B.August 13, 2023Verified Purchase
Hershey®'s Kisses® Candy Favors, Non-Assembled
Zazzle Reviewer Program
These personalized Kisses are the perfect add to my son's wedding guest gift boxes! They arrived on time packed in a styrofoam cooler with with an ice pack, alleviating my worries of not being home to bring them inside immediately from the Oklahoma summer heat! Thank you, Zazzle! Perfect image of the picture I uploaded of the bride and groom!

Tags

Hershey's Candy Favorss
stylehersheykisseswrappersstickersfavirs
All Products
stylehersheykisseswrappersstickersfavirs

Other Info

Product ID: 256547575685720968
Created on: 1/11/2022, 8:59 AM
Rating: G