Tap / click on image to see more RealViewsTM
Sale Price $3.06.  
Original Price $3.60 Comp. value
per button
You save 15%

Stylish Father’s Day Watch – Retro Badge Design wi Button

Qty:
Round
+$1.60
+$0.90
2.25 inch
-$0.90
+$0.60
+$1.75
+$4.15

Other designs from this category

The Zazzle Promise

  • Order with Confidence

    If something goes wrong on our end, we'll make it right, on every order. Learn more!

  • FREE Shipping

    Enjoy FREE shipping with a 30-day free trial of Zazzle Plus – Learn More!

  • Secure Shopping Guaranteed

    100% Secure payment with SSL Encryption.

About Buttons

Sold by

Shape: Round

With Zazzle custom buttons you can do more than just express a political opinion. Since you can add your own designs, pictures, and text you can express just about anything you can think of. Start creating amazing flair today!

  • Available in 5 sizes from 1.25" to 6" diameter
  • Covered with scratch and UV-resistant Mylar
  • Square buttons available too
  • Made in U.S.A.
  • This product contains a functional sharp point. Not for children under 3 years of age.

About This Design

Stylish Father’s Day Watch – Retro Badge Design wi Button

Stylish Father’s Day Watch – Retro Badge Design wi Button

Give your dad the gift of style and sentiment with this retro-inspired Father’s Day watch. Designed with a bold circular badge, elegant stars, and a classic mustache motif, this timepiece is both fashionable and meaningful. A perfect accessory to show your appreciation and love — whether it's for Father’s Day or any day that celebrates him

Customer Reviews

4.8 out of 5 stars rating8.6K Total Reviews
7678 total 5-star reviews636 total 4-star reviews134 total 3-star reviews57 total 2-star reviews73 total 1-star reviews
8,578 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Karissa D.February 28, 2022Verified Purchase
Round, 3 inch
Zazzle Reviewer Program
I love the quality and the color and the design I got to customize them to the way I like my husband and I are different and it was really nice that I could custom mama instead of mommy or mom because I like to be called mama so that was nice and then I was able to make his big sisters to buttons as well so that was really nice. I love the design it’s simple it’s cute I can’t wait to wear them on my baby shower day.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Cynthia U.July 4, 2024Verified Purchase
Round, 2.25 inch
The button was just as expected. My mother's smile was captured so beautifully. The size was just right and the colors we chose were bright. The print was nice and clear. A person ordering should just make sure the wording is lined up in the center before submitting
5.0 out of 5 stars rating
5 out of 5 stars rating
By Will G.November 16, 2021Verified Purchase
Round, 2.25 inch
Zazzle Reviewer Program
I bought the product and I was like this is the right size. It turned out great.

Tags

Buttons
fathergiftstylishdadwatchtimepiecemustachebadge
All Products
fathergiftstylishdadwatchtimepiecemustachebadge

Other Info

Product ID: 256265306726384522
Created on: 6/1/2025, 4:01 AM
Rating: G