Tap / click on image to see more RealViewsTM
Sale Price $15.98.  
Original Price $18.80 Comp. value
per wall decal
You save 15%

Sunshine Smiliey Sun Face Kids Room Wall Decal

Qty:
Single
Decorative Star Burst
Left

Other designs from this category

About Wall Decals

Sold by

Number of Shapes: Walls 360 Custom Wall Decal

Brighten up any room with a custom wall decal from Zazzle and Walls 360! Printed with premium eco-solvent inks on high quality fabric paper, your images, text, and designs will pop off the wall with stunning clarity and color accuracy. Made to be moved, each wall decal can be peeled and repeeled up to one hundred times without damaging the decal or walls. No glue, no frames, no pain – make a space all your own with a customized wall decal!

  • Brilliant high-resolution printing on self-adhesive fabric paper.
  • Easy peel and restick up to 100 times. No wall damage or sticky residue.
  • Manufactured by Walls 360 in Las Vegas, Nevada.
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Sunshine Smiliey Sun Face Kids Room Wall Decal

Sunshine Smiliey Sun Face Kids Room Wall Decal

A cute, happy sun face on a star burst wall decal.

Customer Reviews

4.9 out of 5 stars rating9 Total Reviews
8 total 5-star reviews1 total 4-star reviews0 total 3-star reviews0 total 2-star reviews0 total 1-star reviews
9 Reviews
Reviews for similar products
5 out of 5 stars rating
By S.December 10, 2018Verified Purchase
12"x12" Circle Wall Decal
Zazzle Reviewer Program
I love this. I can put it anywhere on my wall and move it whenever I want. It sticks well but leaves no residue. No need to damage the wall to have a cute picture! Turned out very nice. Quite pleased.
5 out of 5 stars rating
By Lisa C.January 13, 2018Verified Purchase
12"x12" Square Wall Decal
Zazzle Reviewer Program
Very pleased with this wall decal. Perfect size and it arrived to me in pristine condition. Looks great on my grandaughter's wall! Good, vibrant colors and looks great on the wall. Not large, but not tiny either.
5 out of 5 stars rating
By Anna T.March 25, 2014Verified Purchase
12"x12" Circle Wall Decal
Zazzle Reviewer Program
I ordered this wall cling as a decoration. I haven't used it yet, but it is lovely. The coloring was fantastic! The print turned out great, and I was really happy with the product.

Tags

Wall Decals
sunsunshinesun facesmilehappyhappinesskidskids roomwalldecal
All Products
sunsunshinesun facesmilehappyhappinesskidskids roomwalldecal

Other Info

Product ID: 256475241740596715
Created on: 9/5/2012, 3:56 PM
Rating: G