Tap / click on image to see more RealViewsTM
Sale Price $18.36.  
Original Price $22.95 Comp. value
per window cling
You save 20%

Sweet Tooth Monkey Window Cling

Qty:
12" x 12"
Opaque Design: All-over White Underbase
Rectangle

Other designs from this category

About Window Clings

Sold by

Shape: Rectangle

Turn your glass surfaces into decorations, promotions, signage and more with custom window clings. These versatile and reusable vinyl clings stick to glass surfaces through static electricity so leave no sticky residue behind. From displaying new promotions on your business’s window and using that empty window space to boost your brand, to decorating a window in your home, you’ll find so many great uses for these clings.

  • Dynamically Sized - ranging from 4” x 4” to a max of 52” x 72” (or max 72” x 52” if horizontal/landscape is selected)
  • Material - 7.5 mil static cling vinyl
  • Non Adhesive: Sticks to glass surfaces electro-statically
  • Choose from rectangle or custom cut shapes

Application Instructions:

  • Clean the surface you wish to apply the window cling to with hot water and dishwasher soap and wait until dry
  • Next, apply a light mist of water to your surface. Peel the decal from backing paper and place it on your surface, slide it around until you’re happy with its placement
  • Once it’s positioned perfectly, use a squeegee or flat plastic card to remove any air bubbles and wipe your window dry
  • To reposition or remove, simply peel away. It’s non-adhesive so there’ll be no residue left on the surface

Print Process: Opaque Design: All-over White Underbase

Art is printed on a white sheet of plastic making colors look very dynamic. Please note that the white sheet is opaque and obscures text and art when viewed from the back of the window cling.

Adhesive: Cling art faces inward

Adhesive side is on the back of the window cling. All text and art is printed on the front of the window cling and faces towards the person applying it to the window. The art and text printed on the window cling will appear correctly when viewed from the same side of the window that it has been applied.

About This Design

Sweet Tooth Monkey Window Cling

Sweet Tooth Monkey Window Cling

This image shows an adorable baby monkey wearing a red straw hat with pink flowers. The monkey has large, expressive eyes and a sweet smile as it holds a red and white lollipop. It is dressed in a red dress with a white button. The monkey is sitting on a wooden surface.

Customer Reviews

3.7 out of 5 stars rating193 Total Reviews
116 total 5-star reviews11 total 4-star reviews7 total 3-star reviews8 total 2-star reviews51 total 1-star reviews
193 Reviews
Reviews for similar products
5 out of 5 stars rating
By PCS I.October 3, 2025Verified Purchase
Window Cling, Size: 11.00" x 8.00", Style: Opaque Design: All-over White Underbase, Shape: Rectangle, Display: Back of Cling
Wow these are great. Great quality, great price, and great look ! The "cling" works great, put these up weeks ago and they still are "clung" with no issues whatsoever!! We'll done! A+.
1 out of 5 stars rating
By AnonymousSeptember 6, 2024Verified Purchase
Window Cling, Size: 8.00" x 11.00", Style: Automatic Opaque Design: White Underbase, Shape: Rectangle, Display: Back of Cling
This is RIDICULOUS! Extremely poor quality. And to think I had to wait even longer to receive my order because was delayed. Not happy at all with this order.
5 out of 5 stars rating
By Lacy C.November 14, 2021Verified Purchase
Window Cling, Size: 8.00" x 8.00", Style: Advanced Opaque Design: Manual White Underbase, Shape: Rectangle, Display: Front of Cling
Creator Review
a great alternative to stickers, looks wonderful on windows. Clean and clear, I went for the transparent look so I could put it on windows

Tags

Window Clings
monkeyapeanimalwildlifewildmammaljunglelollipopcutehat
All Products
monkeyapeanimalwildlifewildmammaljunglelollipopcutehat

Other Info

Product ID: 256709946835316456
Created on: 10/19/2024, 4:11 AM
Rating: G