Tap / click on image to see more RealViewsTM
Sale Price $29.61.  
Original Price $34.83 Comp. value
each
You save 15%

Symmetric Pink Flower Tiled Pattern on Sage Bath Towel

Qty:

Other designs from this category

About Towels

Sold by

Style: Bath Towel

Turn your bathroom into your own personal oasis with a custom towel perfect for drying you off in style. Towel set is a great gift for many occasions.

  • Dimensions: 30" x 60"
  • Material: front is a polyester blend, back is 100% cotton
  • Sublimation printing allows for vibrant printing designed to last
  • Machine washable, tumble dry on low

About This Design

Symmetric Pink Flower Tiled Pattern on Sage Bath Towel

Symmetric Pink Flower Tiled Pattern on Sage Bath Towel

My design features a beautiful tiled, pink flower motif, within a mosaic frame. This is a repeated, symmetrical pattern placed on a soft sage green, background. Adding a personalized name makes a charming gift idea. This item can be given a personalized name, with the design tool. Change the text and font to a style and color of your choice.

Customer Reviews

4.4 out of 5 stars rating533 Total Reviews
405 total 5-star reviews48 total 4-star reviews19 total 3-star reviews22 total 2-star reviews39 total 1-star reviews
533 Reviews
Reviews for similar products
5 out of 5 stars rating
By Cristian C.December 28, 2021Verified Purchase
Bathroom Towel Set
Zazzle Reviewer Program
These hand towels are excellent they are heavy duty and thick the color is nice and does not fade very high-quality not cheap terry cloth 100% cotton. The printing was excellent the colors are vibrant and look vintage like they should
5 out of 5 stars rating
By Antonia R.February 18, 2022Verified Purchase
Bath Towel
Creator Review
The towel is great! Back and front are made differently. Front is like plush, it still wipes out moist very well which in my opinion is rare. The quality is perfect! The metallic colors are not visible after printing. Design is very close to the original. I thought that colors will be stronger as on the image but they are not, which is also good. Two of the pics look yellowish because of the lighting in my bathroom. You can see how it looks in real on the third one.
5 out of 5 stars rating
By 6.April 18, 2020Verified Purchase
Bathroom Towel Set
Zazzle Reviewer Program
I ordered these towels because I am getting ready to stage my house for sale and wanted some really pretty towels to show off the bathroom. These are an absolutely perfect match for the teal walls and I could not be more pleased. Not only do they look beautiful, they also seem to be very good quality. They are different than any other towels I've had, as the surface fibers are not looped. I love that because I have never liked how most towels have loops that snag and pull no matter how careful you are. I pre-washed them and they came out beautifully. The towels are generously sized and they don't feel flimsy at all. I did not read the description well enough to understand I was paying as much as I was paying for just exactly what was pictured: not a set of two, but a single towel, hand towel and washcloth, so they are way more expensive than I thought (which was a lot, considering). However, I still love them enough that I went ahead and ordered a single additional bath towel so that I would have an actual set, but will need to buy a couple of solid color washcloths. Pricing is weird, because a single wash cloth is priced higher than a large bath towel?? Anyway, if you can afford them, these towels are fantastic. I would never pay this much except to show off a house for sale, but now that I've done it I will love them in my new home as well. Gorgeous! Vibrant Colors and exactly as pictured,..maybe evern better!

Tags

Towels
flowerpatternpinkgreennamesymmetrictilesagemotifmosaic
All Products
flowerpatternpinkgreennamesymmetrictilesagemotifmosaic

Other Info

Product ID: 256053667625050057
Created on: 2/1/2024, 3:29 AM
Rating: G