Tap / click on image to see more RealViewsTM
Sale Price $2.28.  
Original Price $2.68 Comp. value
per sticker
You save 15%

Tarantula Police Bear - Spiky Accessories & Cute Sticker

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Tiny 2" x 2"

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 2" L x 2.5" W
  • Design Area: 2" L x 2" W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.125" border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Tarantula Police Bear - Spiky Accessories & Cute Sticker

Tarantula Police Bear - Spiky Accessories & Cute Sticker

Cute Bear in Hardcore Police Uniform - Spiky & Shiny Style 🐻🕷️🖤✨ "Get ready for a wild twist! This adorable bear is rocking a shiny, black police uniform with spiky accessories, and a surprising guest - a tarantula! But don't worry, its cute face will win you over. 🐻🖤 This design embodies a unique blend of hardcore style and ultimate dreamy kawaii charm, perfect for fashion lovers, spider enthusiasts, and anyone who adores unique cute art with an edgy, unexpected twist. Fully customizable for any Zazzle product, it makes a perfect gift or a lovely treat for yourself! Let this bold bear make a statement! 💖 This design is fully customizable - add your own text or image to make it uniquely yours!" 🐻🕷️🖤✨ "Mach dich bereit für eine wilde Wendung! Dieser bezaubernde Bär rockt eine glänzende, schwarze Polizeiuniform mit stacheligen Accessoires und einem überraschenden Gast - eine Vogelspinne! Aber keine Sorge, sein süßes Gesicht wird dich überzeugen. 🐻🖤 Dieses Design verkörpert eine einzigartige Mischung aus Hardcore-Stil und ultimativem verträumten Kawaii-Charme, perfekt für Modeliebhaber, Spinnenliebhaber und alle, die einzigartige niedliche Kunst mit einem ausgefallenen, unerwarteten Touch lieben. Vollständig anpassbar für jedes Zazzle-Produkt, ist es ein perfektes Geschenk oder eine nette Belohnung für Sie selbst! Lass diesen mutigen Bären ein Statement setzen! 💖 Dieses Design ist vollständig anpassbar - füge deinen eigenen Text oder dein eigenes Bild hinzu, um es einzigartig zu machen!" 🐻🕷️🖤✨ "Préparez-vous à une tournure sauvage ! Cet adorable ours arbore un uniforme de police noir brillant avec des accessoires pointus, et un invité surprise - une tarentule ! Mais ne vous inquiétez pas, son visage mignon vous séduira. 🐻🖤 Ce design incarne un mélange unique de style hardcore et de charme kawaii onirique ultime, parfait pour les amoureux de la mode, les passionnés d'araignées, et tous ceux qui adorent l'art mignon unique avec une touche audacieuse et inattendue. Entièrement personnalisable pour tout produit Zazzle, c'est un cadeau parfait ou une jolie gâterie pour vous-même ! Laissez cet ours audacieux faire une déclaration ! 💖 Ce design est entièrement personnalisable - ajoutez votre propre texte ou image pour le rendre unique !" 🐻🕷️🖤✨ "Preparati per una svolta selvaggia! Questo adorabile orso sfoggia un uniforme da poliziotto nero lucido con accessori appuntiti e un ospite a sorpresa: una tarantola! Ma non preoccuparti, il suo viso carino ti conquisterà. 🐻🖤 Questo design incarna una miscela unica di stile hardcore e massimo fascino kawaii sognante, perfetto per gli amanti della moda, gli appassionati di ragni e chiunque adori l'arte unica e carina con un tocco audace e inaspettato. Completamente personalizzabile per qualsiasi prodotto Zazzle, è un regalo perfetto o una deliziosa coccola per te stesso! Lascia che questo orso audace faccia una dichiarazione! 💖 Questo design è completamente personalizzabile: aggiungi il tuo testo o la tua immagine per renderlo unico!" 🐻🕷️🖤✨ "Design with wild twist! This lovely Bear-Chan wears shiny black police uniforms, spiny accessories, and even surprise guests - Tarantula! But don't worry. I'm sure I'll be crazy about the cute face. 🐻🖤 This design combines a hardcore style with the ultimate dream kawaii charm, and embodies the unique and unique design. Perfect for everyone who loves fashion, spider, and love the unique and cute art with an edge-enabled twist! You can customize any item in Zazzle, so it's perfect for perfect gifts and a nice reward for yourself! Let's claim your personality with this bold bear! 💖 This design is freely customizable - you can add your text or pictures to make it your only special item! " #PoliceBear, #Tarantula, #SpikyFashion, #KawaiiArt, #HardcoreCute, #UniqueStyle, #DreamyCute, #Yumekawaii, #EdgyArt, #BoldFashion #DreamyPastel, #CelestialArt, #CuteSpace,

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
895 total 5-star reviews65 total 4-star reviews27 total 3-star reviews27 total 2-star reviews79 total 1-star reviews
1,093 Reviews
Reviews for similar products
5 out of 5 stars rating
By Aurelia T.May 5, 2022Verified Purchase
Extra-Large 14" x 14" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was able to give us a designer the dimensions of my mini shot glasses and she was able to reduce all the labels onto one sheet we’re all I did was going to change the names and add the table number for my seating chart absolutely perfect. Simple perfect easy to read fit great on my jar
5 out of 5 stars rating
By Nichole M.August 9, 2020Verified Purchase
Large 8" x 8" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These turned out so beautifully and all our guests loved them!! They did not have the orange suit sleeves so I ordered them separately and they fit perfectly into the mailing envelope. I had an issue with the address labels not being ledge able and they redid them and replaced them. They are perfect!
5 out of 5 stars rating
By Jenn K.August 20, 2019Verified Purchase
Medium 6" x 6" Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
Good quality vinyl stickers that stick well but also can be removed without residue. Funny eyes for all sorts of stuff. Printing turned out great and looks just as it appears online.

Tags

Custom-Cut Vinyl Stickers
yukatabearpastelhairhydrangeakawaiiartpearlkimonoelegantcutedreamycuteyumekawaiijapanesestylelonghair
All Products
yukatabearpastelhairhydrangeakawaiiartpearlkimonoelegantcutedreamycuteyumekawaiijapanesestylelonghair

Other Info

Product ID: 256020605305376688
Created on: 6/10/2025, 11:51 AM
Rating: G