Tap / click on image to see more RealViewsTM
Sale Price $2.72.  
Original Price $3.88 Comp. value
per card
You save 30%

Thank You for Help Vintage Girl & Cat

Qty:

Envelopes

Choose from blank envelopes or save time with addressable envelopes

Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+$0.67
+$0.67
-$0.18
Vertical

Other designs from this category

About Folded Thank You Cards

Sold by

Size: Standard, 5" x 7"

Custom thank you cards for small things, big things, and everything in between.

  • Dimensions: 5" x 7" (portrait or landscape)
  • Full color CMYK print process
  • Double-sided printing for no additional cost

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Thank You for Help Vintage Girl & Cat

Thank You for Help Vintage Girl & Cat

This sweet illustration of a girl feeding her cat is the perfect way to say thank you for your help. Image is from Graphics Fairy and is in the public domain. Public-Domain-Download-Girl-Cat-GraphicsFairy

Customer Reviews

4.8 out of 5 stars rating3.6K Total Reviews
3290 total 5-star reviews247 total 4-star reviews48 total 3-star reviews26 total 2-star reviews37 total 1-star reviews
3,648 Reviews
Reviews for similar products
5 out of 5 stars rating
By Tiffany D.July 3, 2025Verified Purchase
Folded Thank You Card, Size: Small, 4" x 5.6", Paper: Signature Matte, Envelopes: White
Creator Review
Really happy with how this printed. There are so many hand drawn details in this design and the printing showed them all!! .
5 out of 5 stars rating
By Tiffany D.July 3, 2025Verified Purchase
Folded Thank You Card, Size: Small, 4" x 5.6", Paper: Signature Matte, Envelopes: White
Creator Review
Really happy with the quality and inside details of the card are super cute. .
5 out of 5 stars rating
By Lynda W.April 29, 2022Verified Purchase
Folded Thank You Card, Size: Small, 4" x 5.6", Paper: Signature Matte, Envelopes: White
Creator Review
Beautifully done from the print to the feel and the fact that I could digitally add down photo to make it my own room it over the top. Beautiful design smooth to the touch feel.

Tags

Folded Thank You Cards
thankyouhelpvintagegirlcatfeedingmilksaucerbowl
All Products
thankyouhelpvintagegirlcatfeedingmilksaucerbowl

Other Info

Product ID: 137663167239947182
Created on: 5/19/2015, 5:48 AM
Rating: G