• Events
Tap / click on image to see more RealViewsTM
Sale Price $15.60.  
Original Price $18.35 Comp. value
per tile
You save 15%

The Griffin's Plume Ceramic Tile

Qty:
  1. Size

Other designs from this category

About Tiles

Sold by

Size: 6" x 6"

Display your favorite photos, images, and quotes on this vibrant ceramic tile. You can use your custom tile as a trivet or to upgrade your home décor. Great for holiday, wedding, and office gifts.

  • Dimensions: 6"l x 6"w; Thickness: 0.19"
  • Weight: 8.5 oz.
  • Made of white ceramic
  • Full-color, full-bleed printing
  • Intended for residential use. Suitable for dry or low-moisture indoor wall applications with brief exposure to water (such as backsplashes which are properly sealed and grouted). Not suitable for use on floors. Not suitable for constantly wet areas (like showers). Protect from exposure to direct sunlight. Not frost resistant.
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 6" x 6". For best results please add 1/8"" bleed

About This Design

The Griffin's Plume Ceramic Tile

The Griffin's Plume Ceramic Tile

Close-up shot of an ornate, decorative tile design. The design features a central, fan-like motif with alternating sections of light purple and light orange. This fan is framed by a green border that curves around the top and sides, with decorative swirls at the bottom corners. The border is further embellished with gold accents, particularly at the top and bottom.

Customer Reviews

4.8 out of 5 stars rating1.1K Total Reviews
961 total 5-star reviews61 total 4-star reviews19 total 3-star reviews11 total 2-star reviews11 total 1-star reviews
1,063 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By GeorgetteApril 28, 2026Verified Purchase
Ceramic Tile, 4.25" x 4.25"
From the pictures we needed to replace two tiles that had the old toothbrush and soap dish and the tile guy said two tiles would have to be removed. The tiles were PERFECT! just a slight color difference to the naked eye but they match pretty darn good. Tile guy had to shave the back because the 1957 tile was thinner but as you can see it worked out great! We are elated over the moon happy, Thank you!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Tracy S.November 16, 2021Verified Purchase
Ceramic Tile, 4.25" x 4.25"
Zazzle Reviewer Program
I really love how these ceramic tiles turned out. Vivid colors and nicely done. Very happy with this product! The colors turned out beautifully! Better than I had hoped for.
5.0 out of 5 stars rating
5 out of 5 stars rating
By AnonymousOctober 14, 2025Verified Purchase
Ceramic Tile, 6" x 6"
THOSE ARE SIMPLY STUNNING!!!! They are beautiful, well framed, well packaged. Planning to use them on wall of a peacock themed guest bathroom. Thank you so much!!! Love them!

Tags

Tiles
artdecoplumeshellpinkgreenwhitevintageceramictile
All Products
artdecoplumeshellpinkgreenwhitevintageceramictile

Other Info

Product ID: 256697075007500530
Created on: 10/10/2025, 10:49 PM
Rating: G 
Related Searches
tilescustom ceramic tile