• Events
Tap / click on image to see more RealViewsTM
Sale Price $127.04.  
Original Price $149.45 Comp. value
per skateboard
You save 15%

The Hero Skateboard

Qty:
  1. Deck Type

  2. Complete Your Board

Other designs from this category

About Skateboards

Sold by

Deck Type: 8 1/2" Skateboard Deck

If you're a passionate boarder, or have one at home and are looking for some great gift ideas, you're in the right place! Our fantastic quality skateboards come in a variety of sizes, and are a perfect pick for both a novice and a pro. By adding your own design to it, you're sure to make a unique deck that'll turn heads. If you're not in a creative mood, don't worry - you can simply pick your favorite design from the selection crafted by our talented Independent Designers.

  • Professional quality skateboard deck made from the very best ingredients
  • Seven plies of premium USA Maple form the Great Lakes region
  • Skateboard specific glue from Franklin.

Complete Your Board: Trucks and Wheels

Add some awesome trucks and wheels to the mix, and you’ll have the skateboard of your dreams! You’ll be able to start coasting down those ramps on your new board right away!

  • Note: Truck & Wheel Size varies by board
  • Truck width: 5.25
  • All terrain skateboard trucks
  • Hanger and baseplate made of high quality aluminum with spring steel axles.
  • Classic polyurethane wheel formula for street, park, and all around skateboarding. 99A hardness.
  • Wheel Size (mm): 52
California Residents: Prop 65 Disclaimer
WarningWARNING: This product can expose you to chemicals including Lead, which are known to the State of California to cause cancer and birth defects or other reproductive harm. For more information, go to www.P65Warnings.ca.gov.

About This Design

The Hero  Skateboard

The Hero Skateboard

Public Domain Comic Book Heroes.

Customer Reviews

4.8 out of 5 stars rating163 Total Reviews
141 total 5-star reviews14 total 4-star reviews2 total 3-star reviews2 total 2-star reviews4 total 1-star reviews
163 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Charlene T.February 16, 2023 • Verified Purchase
8 1/4"
Zazzle Reviewer Program
The colors are bright and amazing my son loved it! It was amazing my son loved it!
5.0 out of 5 stars rating
5 out of 5 stars rating
By S.July 25, 2013 • Verified Purchase
8 1/2"
Creator Review
Had reservations about the print quality when ordering, but the graphics came out exactly as designed - the higher resolution the better (I used 600 DPI and everything was sharp). Extreme heat or cold could peel the decal a bit so make sure its in an even temperature environment. I'm only going to use as display, dont think the decal would hold up under heavy skating use. Printing was exactly as designed, 600 DPI PNG was sharp and gradients very good.
5.0 out of 5 stars rating
5 out of 5 stars rating
By steven c.June 11, 2015 • Verified Purchase
8 1/8"
Zazzle Reviewer Program
great skateboard. great pop. nice concave. overall great purchase. graphic does not handle the wear and tear of grinds and stalls

Tags

skateboardtricksflipsrampgrindingvirtualwheelssportsstreet

Other Info

Product ID: 256080957484048847
Created on: 9/8/2025, 4:13 PM
Rating: G