Tap / click on image to see more RealViewsTM
Sale Price $2.38.  
Original Price $2.80 Comp. value
per sticker
You save 15%

Trendy Pig Sticker

Officially Licensed
Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Extra-Small 3" x 3" Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 3" L x 3.5" W
  • Design Area: 3" L x 3" W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.125" border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Trendy Pig Sticker

Trendy Pig Sticker

This design features a cute watercolor pig wearing eyeglasses.

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
893 total 5-star reviews64 total 4-star reviews27 total 3-star reviews27 total 2-star reviews79 total 1-star reviews
1,090 Reviews
5 out of 5 stars rating
By Debbie C.November 4, 2022Verified Purchase
Extra-Small 3" x 3" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was very impressed with the cut and colors of the sticker. I put it on my laptop just like the image suggested and it makes me happy every time I see it. I love it! The printing job is beautiful. Very professional. And the cutout is gorgeous. Overall just really very well done. I couldn't be happier.
Reviews for similar products
5 out of 5 stars rating
By Aurelia T.May 5, 2022Verified Purchase
Extra-Large 14" x 14" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was able to give us a designer the dimensions of my mini shot glasses and she was able to reduce all the labels onto one sheet we’re all I did was going to change the names and add the table number for my seating chart absolutely perfect. Simple perfect easy to read fit great on my jar
5 out of 5 stars rating
By Nichole M.August 9, 2020Verified Purchase
Large 8" x 8" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These turned out so beautifully and all our guests loved them!! They did not have the orange suit sleeves so I ordered them separately and they fit perfectly into the mailing envelope. I had an issue with the address labels not being ledge able and they redid them and replaced them. They are perfect!

Tags

Custom-Cut Vinyl Stickers
pigfarmglasseseyeglasseswatercoloranimalpigletpaint splash
All Products
pigfarmglasseseyeglasseswatercoloranimalpigletpaint splash

Other Info

Product ID: 256434994669832216
Created on: 4/22/2019, 8:26 AM
Rating: G