Tap / click on image to see more RealViewsTM
Sale Price $2.52.  
Original Price $2.80 Comp. value
per sticker
You save 10%

Trendy Pig Sticker

4.5 out of 5 stars rating
1110 Total Reviews |
by
Officially Licensed
Qty:
Sticker Sheet Size
Paper Type

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by
Custom-Cut Vinyl StickerCreate your own from scratch

Sticker Sheet Size: 3" x 3" Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 3" L x 3.5" W
  • Design Area: 3" L x 3" W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.125" border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Trendy Pig Sticker

Trendy Pig Sticker

This design features a cute watercolor pig wearing eyeglasses.
Animals With Style
Pro
Artwork designed by
View their Store
Message

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
900 total 5-star reviews65 total 4-star reviews27 total 3-star reviews30 total 2-star reviews88 total 1-star reviews
1,110 Reviews
5.0 out of 5 stars rating
5 out of 5 stars rating
By Debbie C.November 4, 2022 • Verified Purchase
3" x 3" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was very impressed with the cut and colors of the sticker. I put it on my laptop just like the image suggested and it makes me happy every time I see it. I love it! The printing job is beautiful. Very professional. And the cutout is gorgeous. Overall just really very well done. I couldn't be happier.
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Aurelia T.May 5, 2022 • Verified Purchase
14" x 14" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was able to give us a designer the dimensions of my mini shot glasses and she was able to reduce all the labels onto one sheet we’re all I did was going to change the names and add the table number for my seating chart absolutely perfect. Simple perfect easy to read fit great on my jar
5.0 out of 5 stars rating
5 out of 5 stars rating
By Nichole M.August 9, 2020 • Verified Purchase
8" x 8" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These turned out so beautifully and all our guests loved them!! They did not have the orange suit sleeves so I ordered them separately and they fit perfectly into the mailing envelope. I had an issue with the address labels not being ledge able and they redid them and replaced them. They are perfect!

Tags

Custom-Cut Vinyl Stickers
pigfarmglasseseyeglasseswatercoloranimalpigletpaint splash
All Products
pigfarmglasseseyeglasseswatercoloranimalpigletpaint splash

Other Info

Product ID: 256434994669832216
Created on: 4/22/2019, 8:26 AM
Rating: G 
Related Searches
flying pig stickersstickers for package birthday party animalstickers to savestickers custom