Tap / click on image to see more RealViewsTM
Sale Price $2.38.  
Original Price $2.80 Comp. value
per sticker
You save 15%

Trendy Pig Sticker

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Extra-Small 3" x 3" Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 3" L x 3.5" H
  • Design Area: 3" L x 3" H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.125" border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Trendy Pig Sticker

Trendy Pig Sticker

This design features a cute watercolor pig wearing eyeglasses.

Customer Reviews

4.6 out of 5 stars rating1.1K Total Reviews
876 total 5-star reviews64 total 4-star reviews27 total 3-star reviews21 total 2-star reviews72 total 1-star reviews
1,060 Reviews
5 out of 5 stars rating
By Debbie C.November 4, 2022Verified Purchase
Extra-Small 3" x 3" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was very impressed with the cut and colors of the sticker. I put it on my laptop just like the image suggested and it makes me happy every time I see it. I love it! The printing job is beautiful. Very professional. And the cutout is gorgeous. Overall just really very well done. I couldn't be happier.
Reviews for similar products
5 out of 5 stars rating
By Aurelia T.May 5, 2022Verified Purchase
Extra-Large 14" x 14" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was able to give us a designer the dimensions of my mini shot glasses and she was able to reduce all the labels onto one sheet we’re all I did was going to change the names and add the table number for my seating chart absolutely perfect. Simple perfect easy to read fit great on my jar
5 out of 5 stars rating
By Nichole M.August 9, 2020Verified Purchase
Large 8" x 8" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These turned out so beautifully and all our guests loved them!! They did not have the orange suit sleeves so I ordered them separately and they fit perfectly into the mailing envelope. I had an issue with the address labels not being ledge able and they redid them and replaced them. They are perfect!

Tags

Custom-Cut Vinyl Stickers
pigfarmglasseseyeglasseswatercoloranimalpigletpaint splash
All Products
pigfarmglasseseyeglasseswatercoloranimalpigletpaint splash

Other Info

Product ID: 256434994669832216
Created on: 4/22/2019, 8:26 AM
Rating: G