Tap / click on image to see more RealViewsTM
Sale Price $65.50.  
Original Price $77.05 Comp. value
per pair of leggings
You save 15%

Tropical Parrot Birds All Over Print Leggings

Qty:

Other designs from this category

About Leggings

Sold by

Style: Leggings

Style and comfort make these the perfect pair of leggings. Custom-made with care; each pair is printed before being sewn, allowing for fun designs on every square inch. These leggings won't lose their shape so get comfy and look cool with your own unique pair.

Due to the cut-and-sew nature of each pair of leggings, designs, and prints may not match up at the seams. We do not recommend designs with words printed on or across the seam as they are hard to match precisely by even the most skilled of dressmakers.

Size & Fit

  • Full length leggings
  • Model is 5'10" and wearing a size S
  • Compression fit due to high spandex content; our leggings hug in all the right places and suit all body types

Fabric & Care

  • Material: Ultra-stretch polyester spandex blend. Legging is 79% polyester, 21% spandex. Capri is 88% polyester, 12% spandex
  • Sturdy, breathable, and stretches to fit your body
  • High spandex composition means compression fit won't lose shape; hugs in all the right places and bounces back after washing
  • Machine wash cold, gentle cycle. Or hand wash. Tumble dry medium heat. Do not bleach
  • Vibrant print won't fade after washing
  • Hand sewn in Canada

About This Design

Tropical Parrot Birds All Over Print Leggings

Tropical Parrot Birds All Over Print Leggings

Awesome collage of vintage botanical fine art of exotic tropical Parrot Birds and habitat Pods, etc., is on these great All Over Print Leggings. Image is public domain due to expired copyright.

Customer Reviews

4.8 out of 5 stars rating818 Total Reviews
700 total 5-star reviews86 total 4-star reviews15 total 3-star reviews8 total 2-star reviews9 total 1-star reviews
818 Reviews
Reviews for similar products
5 out of 5 stars rating
By Heather C.March 27, 2020Verified Purchase
All-Over-Print Leggings, L (12-14)
Zazzle Reviewer Program
Quality is beyond superb, the logo I uploaded looked perfect, the arrived in DAYS! I love the elastic top and the material, too. I designed & ordered a pair for my daughter, who is getting married next week , with her married name, “MRS.,.... “ down one side of the black tights. I cannot WAIT to give them to her!! Of all the gifts I have given her,.. FANCY gifts, I KNOW her tights will be her favorite gift of all!! Best thing= in black (or Navy) you look 20 lbs. THINNER! Perfection!!!! Incredible!!!!
5 out of 5 stars rating
By Nancy H.May 9, 2017Verified Purchase
All-Over-Print Leggings, M (8-10)
Creator Review
These are the most darling pink rose leggings on the market. The dainty interlinked rosette design at the waist is truly unique. The poly-spandex makes for a nice fit and available in sizes 0-16. The printing is vibrant and eye-catching.
5 out of 5 stars rating
By Col's C.November 12, 2018Verified Purchase
All-Over-Print Leggings, L (12-14)
Creator Review
Best leggings I've ever owned. At 6', I've never had leggings that reached beyond mid-calf but these go all the way past the ankle. I'm approx. 150# so ordered them in L but they wrinkle in the thighs which tells me they are a bit too big so next pair I will order an M instead. The fabric feels very high-quality- it's thick but still stretchy and comfy and has a very sleek & smooth look/feel to it. The printing is fantastic. The colors are amazingly vibrant, just as seen on screen when ordering. Be prepared to stand out in the crowd wearing these leggings; I get comments where ever I go when wearing them.

Tags

Leggings
leggingsall over printbirdswildlifeanimalsvintageparrotstropicalexotic birds
All Products
leggingsall over printbirdswildlifeanimalsvintageparrotstropicalexotic birds

Other Info

Product ID: 256579313708620942
Created on: 12/3/2016, 6:47 PM
Rating: G