Tap / click on image to see more RealViewsTM
Sale Price $16.32.  
Original Price $19.20 Comp. value
per wall decal
You save 15%

Unicorn Shape Wall Sticker

Qty:
Single
Unicorn Prancing
Right

Other designs from this category

About Wall Decals

Sold by

Number of Shapes: Walls 360 Custom Wall Decal

Brighten up any room with a custom wall decal from Zazzle and Walls 360! Printed with premium eco-solvent inks on high quality fabric paper, your images, text, and designs will pop off the wall with stunning clarity and color accuracy. Made to be moved, each wall decal can be peeled and repeeled up to one hundred times without damaging the decal or walls. No glue, no frames, no pain – make a space all your own with a customized wall decal!

  • Brilliant high-resolution printing on self-adhesive fabric paper.
  • Easy peel and restick up to 100 times. No wall damage or sticky residue.
  • Manufactured by Walls 360 in Las Vegas, Nevada.
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Unicorn Shape Wall Sticker

Unicorn Shape Wall Sticker

abstract photography art by kaps images

Customer Reviews

4.9 out of 5 stars rating11 Total Reviews
10 total 5-star reviews1 total 4-star reviews0 total 3-star reviews0 total 2-star reviews0 total 1-star reviews
11 Reviews
Reviews for similar products
5 out of 5 stars rating
By AnonymousApril 7, 2026Verified Purchase
12"x12" Square Wall Decal
Exactly as it looked online and is the perfect addition to my kitchen decor. I placed it on my stove with complementary pieces.
5 out of 5 stars rating
By Random W.May 5, 2014Verified Purchase
12"x12" Heart Wall Decal
Zazzle Reviewer Program
It's awesome! No need for nails or sticky tack or tape. Sticks to the wall perfectly--and I've moved it about 4 times with no trouble. Great way to decorate my apartment walls! It's good. A bit lighter than I expected but not much. Very lovely. I love staring at the baby mice as I go to sleep. :)
5 out of 5 stars rating
By AnonymousFebruary 3, 2026Verified Purchase
12"x12" Square Wall Decal
Exactly what I was looking for!

Tags

Wall Decals
unicornunicornsshapeschildrenswalldecaldecalsstickersvinyl skinsabstract
All Products
unicornunicornsshapeschildrenswalldecaldecalsstickersvinyl skinsabstract

Other Info

Product ID: 256459884070547716
Created on: 2/18/2014, 5:24 PM
Rating: G